�ݺ�ߣshows by User: EdelmanDigital

�ݺ�ߣshows by User: EdelmanDigital / http://www.slideshare.net/images/logo.gif �ݺ�ߣshows by User: EdelmanDigital / Thu, 13 Feb 2014 16:49:57 GMT �ݺ�ߣShare feed for �ݺ�ߣshows by User: EdelmanDigital Facebook Graph Search Whitepaper /slideshow/facebook-graph-search-whitepaper/31187484 facebookgraphsearchwhitepaperadamwestinfeb2014-140213164957-phpapp02
]]>
]]> Thu, 13 Feb 2014 16:49:57 GMT /slideshow/facebook-graph-search-whitepaper/31187484 EdelmanDigital@slideshare.net(EdelmanDigital) Facebook Graph Search Whitepaper EdelmanDigital <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/facebookgraphsearchwhitepaperadamwestinfeb2014-140213164957-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" />

Facebook Graph Search Whitepaper from Edelman Digital

]]> 6430 10 https://cdn.slidesharecdn.com/ss_thumbnails/facebookgraphsearchwhitepaperadamwestinfeb2014-140213164957-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds document Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Tendencias en social media https://es.slideshare.net/slideshow/tendencias-en-social-media/27788496 edelman2013-tendenciasensocialmedia-es1-131031143910-phpapp02
]]>
]]> Thu, 31 Oct 2013 14:39:10 GMT https://es.slideshare.net/slideshow/tendencias-en-social-media/27788496 EdelmanDigital@slideshare.net(EdelmanDigital) Tendencias en social media EdelmanDigital <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/edelman2013-tendenciasensocialmedia-es1-131031143910-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" />

from Edelman Digital

]]> 4580 4 https://cdn.slidesharecdn.com/ss_thumbnails/edelman2013-tendenciasensocialmedia-es1-131031143910-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Hacking Public Relations /slideshow/hacking-pr-pdffriendly/27706791 hackingprpdffriendly-131029152311-phpapp02
How Understanding and Embracing Open-Source and Hacker Culture Is Critical to PR’s Future]]>
How Understanding and Embracing Open-Source and Hacker Culture Is Critical to PR’s Future]]> Tue, 29 Oct 2013 15:23:11 GMT /slideshow/hacking-pr-pdffriendly/27706791 EdelmanDigital@slideshare.net(EdelmanDigital) Hacking Public Relations EdelmanDigital How Understanding and Embracing Open-Source and Hacker Culture Is Critical to PR’s Future <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/hackingprpdffriendly-131029152311-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> How Understanding and Embracing Open-Source and Hacker Culture Is Critical to PR’s Future

Hacking Public Relations from Edelman Digital

]]> 33295 14 https://cdn.slidesharecdn.com/ss_thumbnails/hackingprpdffriendly-131029152311-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 10 Things to Do at SXSW /slideshow/10-thingstodoatsxsw/23170062 10-things-to-do-at-sxsw-130618191345-phpapp02
SXSW is where music, film and tech come together. Every year, it gets bigger and more difficult to navigate. Whether you're a veteran of SXSW newbie, this list should be checked off before you leave the Austin city limits.]]>
SXSW is where music, film and tech come together. Every year, it gets bigger and more difficult to navigate. Whether you're a veteran of SXSW newbie, this list should be checked off before you leave the Austin city limits.]]> Tue, 18 Jun 2013 19:13:45 GMT /slideshow/10-thingstodoatsxsw/23170062 EdelmanDigital@slideshare.net(EdelmanDigital) 10 Things to Do at SXSW EdelmanDigital SXSW is where music, film and tech come together. Every year, it gets bigger and more difficult to navigate. Whether you're a veteran of SXSW newbie, this list should be checked off before you leave the Austin city limits. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/10-things-to-do-at-sxsw-130618191345-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> SXSW is where music, film and tech come together. Every year, it gets bigger and more difficult to navigate. Whether you're a veteran of SXSW newbie, this list should be checked off before you leave the Austin city limits.

10 Things to Do at SXSW from Edelman Digital

]]> 2408 3 https://cdn.slidesharecdn.com/ss_thumbnails/10-things-to-do-at-sxsw-130618191345-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds infographic Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Nutro: Owner vs. Dog /slideshow/ultra-ownervs-doginfographicfinal2/23169823 ultraownervsdoginfographicfinal2-130618190216-phpapp01
How do dog owners and their pets respectively think about canine nutrition?]]>
How do dog owners and their pets respectively think about canine nutrition?]]> Tue, 18 Jun 2013 19:02:16 GMT /slideshow/ultra-ownervs-doginfographicfinal2/23169823 EdelmanDigital@slideshare.net(EdelmanDigital) Nutro: Owner vs. Dog EdelmanDigital How do dog owners and their pets respectively think about canine nutrition? <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/ultraownervsdoginfographicfinal2-130618190216-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" /> How do dog owners and their pets respectively think about canine nutrition?

Nutro: Owner vs. Dog from Edelman Digital

]]> 2573 4 https://cdn.slidesharecdn.com/ss_thumbnails/ultraownervsdoginfographicfinal2-130618190216-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds infographic Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Pinterest PInfographic /slideshow/pinterest-pinfographic/23169307 the-pinterest-pinfographic502917e0a3bbd-130618184703-phpapp02
From DIY to Social Media, Pinterest is quickly becoming an outlet for a variety of sectors and brands to engage. Before that first pin take a look at our infographic below to make sure you’re taking the necessary steps towards a noticeable presence on the platform. Take a look at Edelman Digital’s Pinterest account as well!]]>
From DIY to Social Media, Pinterest is quickly becoming an outlet for a variety of sectors and brands to engage. Before that first pin take a look at our infographic below to make sure you’re taking the necessary steps towards a noticeable presence on the platform. Take a look at Edelman Digital’s Pinterest account as well!]]> Tue, 18 Jun 2013 18:47:03 GMT /slideshow/pinterest-pinfographic/23169307 EdelmanDigital@slideshare.net(EdelmanDigital) Pinterest PInfographic EdelmanDigital From DIY to Social Media, Pinterest is quickly becoming an outlet for a variety of sectors and brands to engage. Before that first pin take a look at our infographic below to make sure you’re taking the necessary steps towards a noticeable presence on the platform. Take a look at Edelman Digital’s Pinterest account as well! <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/the-pinterest-pinfographic502917e0a3bbd-130618184703-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> From DIY to Social Media, Pinterest is quickly becoming an outlet for a variety of sectors and brands to engage. Before that first pin take a look at our infographic below to make sure you’re taking the necessary steps towards a noticeable presence on the platform. Take a look at Edelman Digital’s Pinterest account as well!

Pinterest PInfographic from Edelman Digital

]]> 1826 4 https://cdn.slidesharecdn.com/ss_thumbnails/the-pinterest-pinfographic502917e0a3bbd-130618184703-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds infographic White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Creative Newsroom: Brand Storytelling at the Speed of Social /slideshow/creative-newsroom-brand-storytelling-at-the-speed-of-social/20274957 creativenewsroom043013-130430132711-phpapp01
]]>
]]> Tue, 30 Apr 2013 13:27:11 GMT /slideshow/creative-newsroom-brand-storytelling-at-the-speed-of-social/20274957 EdelmanDigital@slideshare.net(EdelmanDigital) Creative Newsroom: Brand Storytelling at the Speed of Social EdelmanDigital <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/creativenewsroom043013-130430132711-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" />

Creative Newsroom: Brand Storytelling at the Speed of Social from Edelman Digital

]]> 40254 13 https://cdn.slidesharecdn.com/ss_thumbnails/creativenewsroom043013-130430132711-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 The Creative Newsroom: Real-Time Marketing Driving the Long-Term Brand Narrative /slideshow/the-creative-newsroom-realtime-marketing-driving-the-longterm-brand-narrative/19636517 edelmancreativenewsroomsd4-22515pm-130422155101-phpapp02
In order to break through the clutter, brands must create engaging, visual content that connects with consumers about things they are thinking and talking about in real-time. But transforming a trending conversation into a brand- relevant, audience-resonant visual in hours instead of days is a radical shift in marketing and communications.]]>
In order to break through the clutter, brands must create engaging, visual content that connects with consumers about things they are thinking and talking about in real-time. But transforming a trending conversation into a brand- relevant, audience-resonant visual in hours instead of days is a radical shift in marketing and communications.]]> Mon, 22 Apr 2013 15:51:01 GMT /slideshow/the-creative-newsroom-realtime-marketing-driving-the-longterm-brand-narrative/19636517 EdelmanDigital@slideshare.net(EdelmanDigital) The Creative Newsroom: Real-Time Marketing Driving the Long-Term Brand Narrative EdelmanDigital In order to break through the clutter, brands must create engaging, visual content that connects with consumers about things they are thinking and talking about in real-time. But transforming a trending conversation into a brand- relevant, audience-resonant visual in hours instead of days is a radical shift in marketing and communications. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/edelmancreativenewsroomsd4-22515pm-130422155101-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> In order to break through the clutter, brands must create engaging, visual content that connects with consumers about things they are thinking and talking about in real-time. But transforming a trending conversation into a brand- relevant, audience-resonant visual in hours instead of days is a radical shift in marketing and communications.

The Creative Newsroom: Real-Time Marketing Driving the Long-Term Brand Narrative from Edelman Digital

]]> 22077 6 https://cdn.slidesharecdn.com/ss_thumbnails/edelmancreativenewsroomsd4-22515pm-130422155101-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds document White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Edelman Digital 2013 Social Media Trends /slideshow/edelman-digital-2013-social-media-trends/16653407 edelman2013socialmediaessentials-130220115614-phpapp02
More people are using social media than ever before – and for longer, on an increasingly diverse array of devices. As a result, newsfeeds are cluttered, and fans are more distracted and discerning. In order to succeed, brands will increasingly turn to real-time creative, analytics and paid media to ensure that high-performing content reaches as many people as possible, at the moment they are most interested, to spark conversations and deepen customer relationships. As media converges, brands will invest in ways to complement original, visual content with fan-sourced creative. Promoting high-performing content that aligns with new “real content” search drivers will become essential. Brands will host epic social events to excite the base and invest in tools that help them target and engage one-on-one more efficiently. And brands will have a little fun in the process, remembering that brandplay can go a long way to telling their story. There are 10 social media essentials that can help guide brands to achieve success in 2013. We explore these essentials and case studies of brands in action. ]]>
More people are using social media than ever before – and for longer, on an increasingly diverse array of devices. As a result, newsfeeds are cluttered, and fans are more distracted and discerning. In order to succeed, brands will increasingly turn to real-time creative, analytics and paid media to ensure that high-performing content reaches as many people as possible, at the moment they are most interested, to spark conversations and deepen customer relationships. As media converges, brands will invest in ways to complement original, visual content with fan-sourced creative. Promoting high-performing content that aligns with new “real content” search drivers will become essential. Brands will host epic social events to excite the base and invest in tools that help them target and engage one-on-one more efficiently. And brands will have a little fun in the process, remembering that brandplay can go a long way to telling their story. There are 10 social media essentials that can help guide brands to achieve success in 2013. We explore these essentials and case studies of brands in action. ]]> Wed, 20 Feb 2013 11:56:14 GMT /slideshow/edelman-digital-2013-social-media-trends/16653407 EdelmanDigital@slideshare.net(EdelmanDigital) Edelman Digital 2013 Social Media Trends EdelmanDigital More people are using social media than ever before – and for longer, on an increasingly diverse array of devices. As a result, newsfeeds are cluttered, and fans are more distracted and discerning. In order to succeed, brands will increasingly turn to real-time creative, analytics and paid media to ensure that high-performing content reaches as many people as possible, at the moment they are most interested, to spark conversations and deepen customer relationships. As media converges, brands will invest in ways to complement original, visual content with fan-sourced creative. ��Promoting high-performing content that aligns with new “real content” search drivers will become essential. Brands will host epic social events to excite the base and invest in tools that help them target and engage one-on-one more efficiently. And brands will have a little fun in the process, remembering that brandplay can go a long way to telling their story. There are 10 social media essentials that can help guide brands to achieve success in 2013. We explore these essentials and case studies of brands in action. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/edelman2013socialmediaessentials-130220115614-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> More people are using social media than ever before – and for longer, on an increasingly diverse array of devices. As a result, newsfeeds are cluttered, and fans are more distracted and discerning. In order to succeed, brands will increasingly turn to real-time creative, analytics and paid media to ensure that high-performing content reaches as many people as possible, at the moment they are most interested, to spark conversations and deepen customer relationships. As media converges, brands will invest in ways to complement original, visual content with fan-sourced creative. ��Promoting high-performing content that aligns with new “real content” search drivers will become essential. Brands will host epic social events to excite the base and invest in tools that help them target and engage one-on-one more efficiently. And brands will have a little fun in the process, remembering that brandplay can go a long way to telling their story. There are 10 social media essentials that can help guide brands to achieve success in 2013. We explore these essentials and case studies of brands in action.

Edelman Digital 2013 Social Media Trends from Edelman Digital

]]> 57525 46 https://cdn.slidesharecdn.com/ss_thumbnails/edelman2013socialmediaessentials-130220115614-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds presentation White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Social Matters: The Ryder Cup /slideshow/social-matters-the-ryder-cup/14562348 slidesharerydercupwrapupv5-121002152601-phpapp01
The Edelman Digital Social Intelligence Command Center, in partnership with MATTER and HootSuite, created Social Matters - A series of data visualizations highlighting social conversations around special events.]]>
The Edelman Digital Social Intelligence Command Center, in partnership with MATTER and HootSuite, created Social Matters - A series of data visualizations highlighting social conversations around special events.]]> Tue, 02 Oct 2012 15:25:58 GMT /slideshow/social-matters-the-ryder-cup/14562348 EdelmanDigital@slideshare.net(EdelmanDigital) Social Matters: The Ryder Cup EdelmanDigital The Edelman Digital Social Intelligence Command Center, in partnership with MATTER and HootSuite, created Social Matters - A series of data visualizations highlighting social conversations around special events. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/slidesharerydercupwrapupv5-121002152601-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" /> The Edelman Digital Social Intelligence Command Center, in partnership with MATTER and HootSuite, created Social Matters - A series of data visualizations highlighting social conversations around special events.

Social Matters: The Ryder Cup from Edelman Digital

]]> 4041 11 https://cdn.slidesharecdn.com/ss_thumbnails/slidesharerydercupwrapupv5-121002152601-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds presentation White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Edelman Mobility Quarterly: Edition One /slideshow/edelman-mobility-quarterly-edition-one/14041162 edelmanmobilityquarterly-editionone-8-14-20121-120822104803-phpapp01
When considering that more than half of Americans is now carrying a computer in his/her pocket, many technologists and marketers have blindly rushed to address mobility as it leads us to who-knows-where. So much of desktop behavior such as email and the web have followed us here, while incumbent text messaging and a newfound lust for apps is chewing away at time spent on the device. Through all of this prescriptive technology, it is critical to respect and understand that liberation from the desktop carries with it disruptions from the offline world and traditional media. These observances and some telling data are included in this first edition of the Edelman Mobility Quarterly.]]>
When considering that more than half of Americans is now carrying a computer in his/her pocket, many technologists and marketers have blindly rushed to address mobility as it leads us to who-knows-where. So much of desktop behavior such as email and the web have followed us here, while incumbent text messaging and a newfound lust for apps is chewing away at time spent on the device. Through all of this prescriptive technology, it is critical to respect and understand that liberation from the desktop carries with it disruptions from the offline world and traditional media. These observances and some telling data are included in this first edition of the Edelman Mobility Quarterly.]]> Wed, 22 Aug 2012 10:47:59 GMT /slideshow/edelman-mobility-quarterly-edition-one/14041162 EdelmanDigital@slideshare.net(EdelmanDigital) Edelman Mobility Quarterly: Edition One EdelmanDigital When considering that more than half of Americans is now carrying a computer in his/her pocket, many technologists and marketers have blindly rushed to address mobility as it leads us to who-knows-where. So much of desktop behavior such as email and the web have followed us here, while incumbent text messaging and a newfound lust for apps is chewing away at time spent on the device. Through all of this prescriptive technology, it is critical to respect and understand that liberation from the desktop carries with it disruptions from the offline world and traditional media. These observances and some telling data are included in this first edition of the Edelman Mobility Quarterly. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/edelmanmobilityquarterly-editionone-8-14-20121-120822104803-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" /> When considering that more than half of Americans is now carrying a computer in his/her pocket, many technologists and marketers have blindly rushed to address mobility as it leads us to who-knows-where. So much of desktop behavior such as email and the web have followed us here, while incumbent text messaging and a newfound lust for apps is chewing away at time spent on the device. Through all of this prescriptive technology, it is critical to respect and understand that liberation from the desktop carries with it disruptions from the offline world and traditional media. These observances and some telling data are included in this first edition of the Edelman Mobility Quarterly.

Edelman Mobility Quarterly: Edition One from Edelman Digital

]]> 3037 5 https://cdn.slidesharecdn.com/ss_thumbnails/edelmanmobilityquarterly-editionone-8-14-20121-120822104803-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds document White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Social Business for Complex Organizations /slideshow/socialbiz-v2final-13778281/13778281 socialbizv2final-120727111421-phpapp02
Complex organizations must integrate social into how they do business despite the shifts needed to make it happen. Contact David.Armano[at]Edelman.com for more information on Social Business Planning and how it can help your organization integrate social at scale. ]]>
Complex organizations must integrate social into how they do business despite the shifts needed to make it happen. Contact David.Armano[at]Edelman.com for more information on Social Business Planning and how it can help your organization integrate social at scale. ]]> Fri, 27 Jul 2012 11:14:19 GMT /slideshow/socialbiz-v2final-13778281/13778281 EdelmanDigital@slideshare.net(EdelmanDigital) Social Business for Complex Organizations EdelmanDigital Complex organizations must integrate social into how they do business despite the shifts needed to make it happen. Contact David.Armano[at]Edelman.com for more information on Social Business Planning and how it can help your organization integrate social at scale. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/socialbizv2final-120727111421-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> Complex organizations must integrate social into how they do business despite the shifts needed to make it happen. Contact David.Armano[at]Edelman.com for more information on Social Business Planning and how it can help your organization integrate social at scale.

Social Business for Complex Organizations from Edelman Digital

]]> 26760 21 https://cdn.slidesharecdn.com/ss_thumbnails/socialbizv2final-120727111421-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds presentation White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Edelman's Social Intelligence Command Center (SICC) /slideshow/edelmans-social-intelligence-command-center-sicc/13324964 sicc-120614093628-phpapp01
Edelman's Social Intelligence Command Center or "SICC" is the firm's proprietary system of combining real time analytics with insights, content development, engagement strategies and tactics. SICC's are a combination of people (staffing), process and a variety of tech platforms converged in collaborative physical spaces. This presentation outlines how the space operates in combination with Edelman's distinct SICC approach. For more information please reach out to david(dot)armano(at)edelman(dot)com.]]>
Edelman's Social Intelligence Command Center or "SICC" is the firm's proprietary system of combining real time analytics with insights, content development, engagement strategies and tactics. SICC's are a combination of people (staffing), process and a variety of tech platforms converged in collaborative physical spaces. This presentation outlines how the space operates in combination with Edelman's distinct SICC approach. For more information please reach out to david(dot)armano(at)edelman(dot)com.]]> Thu, 14 Jun 2012 09:36:26 GMT /slideshow/edelmans-social-intelligence-command-center-sicc/13324964 EdelmanDigital@slideshare.net(EdelmanDigital) Edelman's Social Intelligence Command Center (SICC) EdelmanDigital Edelman's Social Intelligence Command Center or "SICC" is the firm's proprietary system of combining real time analytics with insights, content development, engagement strategies and tactics. SICC's are a combination of people (staffing), process and a variety of tech platforms converged in collaborative physical spaces. This presentation outlines how the space operates in combination with Edelman's distinct SICC approach. For more information please reach out to david(dot)armano(at)edelman(dot)com. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/sicc-120614093628-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" /> Edelman's Social Intelligence Command Center or "SICC" is the firm's proprietary system of combining real time analytics with insights, content development, engagement strategies and tactics. SICC's are a combination of people (staffing), process and a variety of tech platforms converged in collaborative physical spaces. This presentation outlines how the space operates in combination with Edelman's distinct SICC approach. For more information please reach out to david(dot)armano(at)edelman(dot)com.

Edelman's Social Intelligence Command Center (SICC) from Edelman Digital

]]> 26208 20 https://cdn.slidesharecdn.com/ss_thumbnails/sicc-120614093628-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 APAC Social Media Map /slideshow/apac-social-media-map/7982750 apacsocialmediamap-110516105833-phpapp01
Data about social media use and trends across our APAC. ]]>
Data about social media use and trends across our APAC. ]]> Mon, 16 May 2011 10:58:27 GMT /slideshow/apac-social-media-map/7982750 EdelmanDigital@slideshare.net(EdelmanDigital) APAC Social Media Map EdelmanDigital Data about social media use and trends across our APAC. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/apacsocialmediamap-110516105833-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" /> Data about social media use and trends across our APAC.

APAC Social Media Map from Edelman Digital

]]> 3417 3 https://cdn.slidesharecdn.com/ss_thumbnails/apacsocialmediamap-110516105833-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds document White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Authority in the Age of Overload /slideshow/authority-in-the-age-of-overload/7954161 authorityintheageofoverload-110513103557-phpapp01
Social media is out of beta. We’re entering the era of validation. In the Validation Era, intimacy is in and publicness may be out - or at least on the decline. Quality is the new black. What this means that both individuals and businesses will need to increasingly work harder to earn their way in and remain in their stakeholders' circle of trust. During this session, Steve Rubel will explain how businesses can activate their domain-level experts to share their knowledge across four spheres of media – traditional, “tradigital,” owned and social.]]>
Social media is out of beta. We’re entering the era of validation. In the Validation Era, intimacy is in and publicness may be out - or at least on the decline. Quality is the new black. What this means that both individuals and businesses will need to increasingly work harder to earn their way in and remain in their stakeholders' circle of trust. During this session, Steve Rubel will explain how businesses can activate their domain-level experts to share their knowledge across four spheres of media – traditional, “tradigital,” owned and social.]]> Fri, 13 May 2011 10:35:53 GMT /slideshow/authority-in-the-age-of-overload/7954161 EdelmanDigital@slideshare.net(EdelmanDigital) Authority in the Age of Overload EdelmanDigital Social media is out of beta. We’re entering the era of validation. In the Validation Era, intimacy is in and publicness may be out - or at least on the decline. Quality is the new black. What this means that both individuals and businesses will need to increasingly work harder to earn their way in and remain in their stakeholders' circle of trust. During this session, Steve Rubel will explain how businesses can activate their domain-level experts to share their knowledge across four spheres of media – traditional, “tradigital,” owned and social. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/authorityintheageofoverload-110513103557-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" /> Social media is out of beta. We’re entering the era of validation. In the Validation Era, intimacy is in and publicness may be out - or at least on the decline. Quality is the new black. What this means that both individuals and businesses will need to increasingly work harder to earn their way in and remain in their stakeholders' circle of trust. During this session, Steve Rubel will explain how businesses can activate their domain-level experts to share their knowledge across four spheres of media – traditional, “tradigital,” owned and social.

Authority in the Age of Overload from Edelman Digital

]]> 17220 6 https://cdn.slidesharecdn.com/ss_thumbnails/authorityintheageofoverload-110513103557-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds presentation White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 The Long Road Back: 2011 Edelman Trust in U.S. Financial Services Survey /slideshow/the-long-road-back-2011-edelman-trust-in-us-financial-services-survey/7219921 tfs2011-110310102844-phpapp02
Edelman’s Financial Communications group presents the findings of its second annual Trust in U.S. Financial Services Survey. The questions were fielded in November 2010 to gauge the level of trust individual investors feel in relation to financial services companies, professionals and regulations. ]]>
Edelman’s Financial Communications group presents the findings of its second annual Trust in U.S. Financial Services Survey. The questions were fielded in November 2010 to gauge the level of trust individual investors feel in relation to financial services companies, professionals and regulations. ]]> Thu, 10 Mar 2011 10:28:43 GMT /slideshow/the-long-road-back-2011-edelman-trust-in-us-financial-services-survey/7219921 EdelmanDigital@slideshare.net(EdelmanDigital) The Long Road Back: 2011 Edelman Trust in U.S. Financial Services Survey EdelmanDigital Edelman’s Financial Communications group presents the findings of its second annual Trust in U.S. Financial Services Survey. The questions were fielded in November 2010 to gauge the level of trust individual investors feel in relation to financial services companies, professionals and regulations. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/tfs2011-110310102844-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> Edelman’s Financial Communications group presents the findings of its second annual Trust in U.S. Financial Services Survey. The questions were fielded in November 2010 to gauge the level of trust individual investors feel in relation to financial services companies, professionals and regulations.

The Long Road Back: 2011 Edelman Trust in U.S. Financial Services Survey from Edelman Digital

]]> 2109 2 https://cdn.slidesharecdn.com/ss_thumbnails/tfs2011-110310102844-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Attentionomics Captivating Attention in the Age of Content Decay /slideshow/attentionomics-captivating-attention-in-the-age-of-content-decay/6841334 attentionomicsexternal-110207122813-phpapp01
Attention is linked with economic value creation. However, with infinite content options (space) yet finite attention (time) and personalized social algorithms curating it all for us, it's going to be increasingly challenging to stand out. In this presentation, Steve Rubel (SVP/Director of Insights), explains the issue in detail along with practical solutions.]]>
Attention is linked with economic value creation. However, with infinite content options (space) yet finite attention (time) and personalized social algorithms curating it all for us, it's going to be increasingly challenging to stand out. In this presentation, Steve Rubel (SVP/Director of Insights), explains the issue in detail along with practical solutions.]]> Mon, 07 Feb 2011 12:28:08 GMT /slideshow/attentionomics-captivating-attention-in-the-age-of-content-decay/6841334 EdelmanDigital@slideshare.net(EdelmanDigital) Attentionomics Captivating Attention in the Age of Content Decay EdelmanDigital Attention is linked with economic value creation. However, with infinite content options (space) yet finite attention (time) and personalized social algorithms curating it all for us, it's going to be increasingly challenging to stand out. In this presentation, Steve Rubel (SVP/Director of Insights), explains the issue in detail along with practical solutions. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/attentionomicsexternal-110207122813-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" /> Attention is linked with economic value creation. However, with infinite content options (space) yet finite attention (time) and personalized social algorithms curating it all for us, it's going to be increasingly challenging to stand out. In this presentation, Steve Rubel (SVP/Director of Insights), explains the issue in detail along with practical solutions.

Attentionomics Captivating Attention in the Age of Content Decay from Edelman Digital

]]> 12970 11 https://cdn.slidesharecdn.com/ss_thumbnails/attentionomicsexternal-110207122813-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds presentation White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 2011 Edelman Trust Barometer: Global & Country Insights /slideshow/edelman-trust-barometer-executive-findings-6689233/6689233 edelmantrustbarometerexecutivefindings-110124175807-phpapp02
A 23-country study that tracks the attitudes of informed publics towards institutions and sources of information.]]>
A 23-country study that tracks the attitudes of informed publics towards institutions and sources of information.]]> Mon, 24 Jan 2011 17:58:02 GMT /slideshow/edelman-trust-barometer-executive-findings-6689233/6689233 EdelmanDigital@slideshare.net(EdelmanDigital) 2011 Edelman Trust Barometer: Global & Country Insights EdelmanDigital A 23-country study that tracks the attitudes of informed publics towards institutions and sources of information. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/edelmantrustbarometerexecutivefindings-110124175807-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> A 23-country study that tracks the attitudes of informed publics towards institutions and sources of information.

2011 Edelman Trust Barometer: Global & Country Insights from Edelman Digital

]]> 13520 19 https://cdn.slidesharecdn.com/ss_thumbnails/edelmantrustbarometerexecutivefindings-110124175807-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds presentation White http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 Edelman Digital Celebrates Community Manager Appreciation Day /slideshow/edelman-digital-celebrate/6687632 cmad2011-110124142657-phpapp01
At Edelman, we have community managers that perform activities on behalf of our clients. We thought we'd turn to these talented individuals for tips and advice for community managers. We also gathered advice from others in the field that either perform community management or champion the profession/activity. Take a look through the advice of our global team and the brand representatives from Boingo, HP (client), Radian6 and many more.]]>
At Edelman, we have community managers that perform activities on behalf of our clients. We thought we'd turn to these talented individuals for tips and advice for community managers. We also gathered advice from others in the field that either perform community management or champion the profession/activity. Take a look through the advice of our global team and the brand representatives from Boingo, HP (client), Radian6 and many more.]]> Mon, 24 Jan 2011 14:26:52 GMT /slideshow/edelman-digital-celebrate/6687632 EdelmanDigital@slideshare.net(EdelmanDigital) Edelman Digital Celebrates Community Manager Appreciation Day EdelmanDigital At Edelman, we have community managers that perform activities on behalf of our clients. We thought we'd turn to these talented individuals for tips and advice for community managers. We also gathered advice from others in the field that either perform community management or champion the profession/activity. Take a look through the advice of our global team and the brand representatives from Boingo, HP (client), Radian6 and many more. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/cmad2011-110124142657-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds" /> At Edelman, we have community managers that perform activities on behalf of our clients. We thought we'd turn to these talented individuals for tips and advice for community managers. We also gathered advice from others in the field that either perform community management or champion the profession/activity. Take a look through the advice of our global team and the brand representatives from Boingo, HP (client), Radian6 and many more.

Edelman Digital Celebrates Community Manager Appreciation Day from Edelman Digital

]]> 5462 13 https://cdn.slidesharecdn.com/ss_thumbnails/cmad2011-110124142657-phpapp01-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 EMEA Twitter Usage Growth November 2009 - November 2010 /slideshow/emea-twitter-usage-growth-november-2009-november-2010/6507370 emeatwitterusagegrowth-110110103203-phpapp02
A look at Twitter usage growth in EMEA from November 2009 to November 2010. Data provided by ComScore. ]]>
A look at Twitter usage growth in EMEA from November 2009 to November 2010. Data provided by ComScore. ]]> Mon, 10 Jan 2011 10:31:24 GMT /slideshow/emea-twitter-usage-growth-november-2009-november-2010/6507370 EdelmanDigital@slideshare.net(EdelmanDigital) EMEA Twitter Usage Growth November 2009 - November 2010 EdelmanDigital A look at Twitter usage growth in EMEA from November 2009 to November 2010. Data provided by ComScore. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/emeatwitterusagegrowth-110110103203-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds" /> A look at Twitter usage growth in EMEA from November 2009 to November 2010. Data provided by ComScore.

EMEA Twitter Usage Growth November 2009 - November 2010 from Edelman Digital

]]> 2225 5 https://cdn.slidesharecdn.com/ss_thumbnails/emeatwitterusagegrowth-110110103203-phpapp02-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post

http://activitystrea.ms/schema/1.0/posted

1 https://cdn.slidesharecdn.com/profile-photo-EdelmanDigital-48x48.jpg?cb=1522908459 Edelman is a leading global communications marketing firm that partners with many of the world’s largest and emerging businesses and organizations, helping them evolve, promote and protect their brands and reputations. Follow EdelmanInsights to remain updated on insights from across the Edelman network. edelmandigital.com https://cdn.slidesharecdn.com/ss_thumbnails/facebookgraphsearchwhitepaperadamwestinfeb2014-140213164957-phpapp02-thumbnail.jpg?width=320&height=320&fit=bounds slideshow/facebook-graph-search-whitepaper/31187484 Facebook Graph Search ... https://cdn.slidesharecdn.com/ss_thumbnails/edelman2013-tendenciasensocialmedia-es1-131031143910-phpapp02-thumbnail.jpg?width=320&height=320&fit=bounds slideshow/tendencias-en-social-media/27788496 Tendencias en social m... https://cdn.slidesharecdn.com/ss_thumbnails/hackingprpdffriendly-131029152311-phpapp02-thumbnail.jpg?width=320&height=320&fit=bounds slideshow/hacking-pr-pdffriendly/27706791 Hacking Public Relations