ºÝºÝߣshows by User: wafaabenjamin / http://www.slideshare.net/images/logo.gif ºÝºÝߣshows by User: wafaabenjamin / Fri, 27 Dec 2024 07:28:34 GMT ºÝºÝߣShare feed for ºÝºÝߣshows by User: wafaabenjamin Sacrospinous Ligament Fixation for Pelvic Organ Prolapse - Latest Evidence.pptx /slideshow/sacrospinous-ligament-fixation-for-pelvic-organ-prolapse-latest-evidence-pptx/274424760 sacrospinousligamentfixationforpelvicorganprolapse-latestevidence-241227072834-2dc7bd51
Sacrospinous Ligament Fixation (SSLF) for Pelvic Organ Prolapse (POP) Sacrospinous ligament fixation (SSLF) is a key surgical procedure for managing pelvic organ prolapse (POP), particularly apical prolapse, encompassing uterine and vaginal vault prolapse. This technique involves attaching the prolapsed vaginal apex or uterine cervix to the sacrospinous ligament, offering durable apical support. The concept of SSLF, first introduced in the mid-20th century, has evolved significantly. Various approaches—unilateral or bilateral fixation, direct visualization, and suture placement using innovative tools—enhance surgical precision and outcomes. Techniques can be customized based on the patient’s anatomy, type of prolapse, and the surgeon’s expertise. Complications such as gluteal pain, infection, and recurrence highlight the need for meticulous dissection and suture placement. SSLF is often compared with sacrocolpopexy (ASC), another prominent technique for POP management. A comprehensive meta-analysis of randomized controlled trials (RCTs) and observational studies reveals that SSLF offers shorter operative times, lower hemorrhage rates, and fewer gastrointestinal complications than ASC. However, ASC demonstrates superior anatomical durability and reduced recurrence rates, particularly in sexually active women. The choice between SSLF and ASC depends on individual patient needs, including anatomical considerations, risk profiles, and recovery goals. Despite its established efficacy, SSLF faces challenges such as the absence of standardized techniques, limited RCTs comparing surgical approaches, and varying long-term outcomes. Future advancements in training, comparative studies, and patient-centered care will continue to shape the role of SSLF in managing POP effectively. Through innovation and evidence-based practices, we can achieve optimal outcomes for women affected by POP, ensuring that surgical interventions align with safety, efficacy, and patient satisfaction. ]]>

Sacrospinous Ligament Fixation (SSLF) for Pelvic Organ Prolapse (POP) Sacrospinous ligament fixation (SSLF) is a key surgical procedure for managing pelvic organ prolapse (POP), particularly apical prolapse, encompassing uterine and vaginal vault prolapse. This technique involves attaching the prolapsed vaginal apex or uterine cervix to the sacrospinous ligament, offering durable apical support. The concept of SSLF, first introduced in the mid-20th century, has evolved significantly. Various approaches—unilateral or bilateral fixation, direct visualization, and suture placement using innovative tools—enhance surgical precision and outcomes. Techniques can be customized based on the patient’s anatomy, type of prolapse, and the surgeon’s expertise. Complications such as gluteal pain, infection, and recurrence highlight the need for meticulous dissection and suture placement. SSLF is often compared with sacrocolpopexy (ASC), another prominent technique for POP management. A comprehensive meta-analysis of randomized controlled trials (RCTs) and observational studies reveals that SSLF offers shorter operative times, lower hemorrhage rates, and fewer gastrointestinal complications than ASC. However, ASC demonstrates superior anatomical durability and reduced recurrence rates, particularly in sexually active women. The choice between SSLF and ASC depends on individual patient needs, including anatomical considerations, risk profiles, and recovery goals. Despite its established efficacy, SSLF faces challenges such as the absence of standardized techniques, limited RCTs comparing surgical approaches, and varying long-term outcomes. Future advancements in training, comparative studies, and patient-centered care will continue to shape the role of SSLF in managing POP effectively. Through innovation and evidence-based practices, we can achieve optimal outcomes for women affected by POP, ensuring that surgical interventions align with safety, efficacy, and patient satisfaction. ]]>
Fri, 27 Dec 2024 07:28:34 GMT /slideshow/sacrospinous-ligament-fixation-for-pelvic-organ-prolapse-latest-evidence-pptx/274424760 wafaabenjamin@slideshare.net(wafaabenjamin) Sacrospinous Ligament Fixation for Pelvic Organ Prolapse - Latest Evidence.pptx wafaabenjamin Sacrospinous Ligament Fixation (SSLF) for Pelvic Organ Prolapse (POP) Sacrospinous ligament fixation (SSLF) is a key surgical procedure for managing pelvic organ prolapse (POP), particularly apical prolapse, encompassing uterine and vaginal vault prolapse. This technique involves attaching the prolapsed vaginal apex or uterine cervix to the sacrospinous ligament, offering durable apical support. The concept of SSLF, first introduced in the mid-20th century, has evolved significantly. Various approaches—unilateral or bilateral fixation, direct visualization, and suture placement using innovative tools—enhance surgical precision and outcomes. Techniques can be customized based on the patient’s anatomy, type of prolapse, and the surgeon’s expertise. Complications such as gluteal pain, infection, and recurrence highlight the need for meticulous dissection and suture placement. SSLF is often compared with sacrocolpopexy (ASC), another prominent technique for POP management. A comprehensive meta-analysis of randomized controlled trials (RCTs) and observational studies reveals that SSLF offers shorter operative times, lower hemorrhage rates, and fewer gastrointestinal complications than ASC. However, ASC demonstrates superior anatomical durability and reduced recurrence rates, particularly in sexually active women. The choice between SSLF and ASC depends on individual patient needs, including anatomical considerations, risk profiles, and recovery goals. Despite its established efficacy, SSLF faces challenges such as the absence of standardized techniques, limited RCTs comparing surgical approaches, and varying long-term outcomes. Future advancements in training, comparative studies, and patient-centered care will continue to shape the role of SSLF in managing POP effectively. Through innovation and evidence-based practices, we can achieve optimal outcomes for women affected by POP, ensuring that surgical interventions align with safety, efficacy, and patient satisfaction. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/sacrospinousligamentfixationforpelvicorganprolapse-latestevidence-241227072834-2dc7bd51-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Sacrospinous Ligament Fixation (SSLF) for Pelvic Organ Prolapse (POP) Sacrospinous ligament fixation (SSLF) is a key surgical procedure for managing pelvic organ prolapse (POP), particularly apical prolapse, encompassing uterine and vaginal vault prolapse. This technique involves attaching the prolapsed vaginal apex or uterine cervix to the sacrospinous ligament, offering durable apical support. The concept of SSLF, first introduced in the mid-20th century, has evolved significantly. Various approaches—unilateral or bilateral fixation, direct visualization, and suture placement using innovative tools—enhance surgical precision and outcomes. Techniques can be customized based on the patient’s anatomy, type of prolapse, and the surgeon’s expertise. Complications such as gluteal pain, infection, and recurrence highlight the need for meticulous dissection and suture placement. SSLF is often compared with sacrocolpopexy (ASC), another prominent technique for POP management. A comprehensive meta-analysis of randomized controlled trials (RCTs) and observational studies reveals that SSLF offers shorter operative times, lower hemorrhage rates, and fewer gastrointestinal complications than ASC. However, ASC demonstrates superior anatomical durability and reduced recurrence rates, particularly in sexually active women. The choice between SSLF and ASC depends on individual patient needs, including anatomical considerations, risk profiles, and recovery goals. Despite its established efficacy, SSLF faces challenges such as the absence of standardized techniques, limited RCTs comparing surgical approaches, and varying long-term outcomes. Future advancements in training, comparative studies, and patient-centered care will continue to shape the role of SSLF in managing POP effectively. Through innovation and evidence-based practices, we can achieve optimal outcomes for women affected by POP, ensuring that surgical interventions align with safety, efficacy, and patient satisfaction.
Sacrospinous Ligament Fixation for Pelvic Organ Prolapse - Latest Evidence.pptx from Wafaa Benjamin
]]>
114 0 https://cdn.slidesharecdn.com/ss_thumbnails/sacrospinousligamentfixationforpelvicorganprolapse-latestevidence-241227072834-2dc7bd51-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Non-Mesh surgery for Stress Urinary Incontinence /slideshow/non-mesh-surgery-for-stress-urinary-incontinence/274423503 non-meshsurgeryforsuiwafaabasta-241227064309-da0b674e
This presentation explores the evolving landscape of non-mesh surgical options for stress urinary incontinence (SUI) amidst global concerns about mesh safety. It reviews historical and current surgical techniques, including retropubic colposuspension and autologous fascial slings, alongside guidelines from NICE and other authorities. Challenges such as training, ethical considerations, patient-centered care, and global disparities in practice are discussed. Emphasizing informed consent, robust clinical governance, and the need for specialized training programs, the presentation highlights the importance of collaboration to standardize practices and improve outcomes. By advancing non-mesh options, we aim to transform women's pelvic health care worldwide.]]>

This presentation explores the evolving landscape of non-mesh surgical options for stress urinary incontinence (SUI) amidst global concerns about mesh safety. It reviews historical and current surgical techniques, including retropubic colposuspension and autologous fascial slings, alongside guidelines from NICE and other authorities. Challenges such as training, ethical considerations, patient-centered care, and global disparities in practice are discussed. Emphasizing informed consent, robust clinical governance, and the need for specialized training programs, the presentation highlights the importance of collaboration to standardize practices and improve outcomes. By advancing non-mesh options, we aim to transform women's pelvic health care worldwide.]]>
Fri, 27 Dec 2024 06:43:09 GMT /slideshow/non-mesh-surgery-for-stress-urinary-incontinence/274423503 wafaabenjamin@slideshare.net(wafaabenjamin) Non-Mesh surgery for Stress Urinary Incontinence wafaabenjamin This presentation explores the evolving landscape of non-mesh surgical options for stress urinary incontinence (SUI) amidst global concerns about mesh safety. It reviews historical and current surgical techniques, including retropubic colposuspension and autologous fascial slings, alongside guidelines from NICE and other authorities. Challenges such as training, ethical considerations, patient-centered care, and global disparities in practice are discussed. Emphasizing informed consent, robust clinical governance, and the need for specialized training programs, the presentation highlights the importance of collaboration to standardize practices and improve outcomes. By advancing non-mesh options, we aim to transform women's pelvic health care worldwide. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/non-meshsurgeryforsuiwafaabasta-241227064309-da0b674e-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> This presentation explores the evolving landscape of non-mesh surgical options for stress urinary incontinence (SUI) amidst global concerns about mesh safety. It reviews historical and current surgical techniques, including retropubic colposuspension and autologous fascial slings, alongside guidelines from NICE and other authorities. Challenges such as training, ethical considerations, patient-centered care, and global disparities in practice are discussed. Emphasizing informed consent, robust clinical governance, and the need for specialized training programs, the presentation highlights the importance of collaboration to standardize practices and improve outcomes. By advancing non-mesh options, we aim to transform women&#39;s pelvic health care worldwide.
Non-Mesh surgery for Stress Urinary Incontinence from Wafaa Benjamin
]]>
336 0 https://cdn.slidesharecdn.com/ss_thumbnails/non-meshsurgeryforsuiwafaabasta-241227064309-da0b674e-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Pre-term labour.pptx /wafaabenjamin/preterm-labourpptx pre-termlabour-220523090349-cc403a54
Pre-term labour, could it be predicted? Pre-term labour (PTL) is defined as labour less than 37 completed weeks or 259 days. 15 million PT babies are delivered annually worldwide with a global rate of about 11% with rising trends in most countries. This represents a serious health and economic challenge. The objective of early prediction of PTL is to Identify women at risk so, delaying preterm birth by Interventions long enough to optimize the outcome for the fetus. Prediction could be done by: -Pre-conceptual/early prenatal evaluation - Prenatal Ultrasound markers - Biomarker predictors Highlights on diagnosing PTL for women with intact membranes and preterm prelabour rupture of membranes (P-PROM) will be presented plus recommended prophylactic interventions as prophylactic vaginal progesterone, prophylactic cervical cerclage & 'Rescue' cervical cerclage. Treatment essentials of PTL include tocolysis, maternal corticosteroids & Magnesium Sulphate. ]]>

Pre-term labour, could it be predicted? Pre-term labour (PTL) is defined as labour less than 37 completed weeks or 259 days. 15 million PT babies are delivered annually worldwide with a global rate of about 11% with rising trends in most countries. This represents a serious health and economic challenge. The objective of early prediction of PTL is to Identify women at risk so, delaying preterm birth by Interventions long enough to optimize the outcome for the fetus. Prediction could be done by: -Pre-conceptual/early prenatal evaluation - Prenatal Ultrasound markers - Biomarker predictors Highlights on diagnosing PTL for women with intact membranes and preterm prelabour rupture of membranes (P-PROM) will be presented plus recommended prophylactic interventions as prophylactic vaginal progesterone, prophylactic cervical cerclage & 'Rescue' cervical cerclage. Treatment essentials of PTL include tocolysis, maternal corticosteroids & Magnesium Sulphate. ]]>
Mon, 23 May 2022 09:03:49 GMT /wafaabenjamin/preterm-labourpptx wafaabenjamin@slideshare.net(wafaabenjamin) Pre-term labour.pptx wafaabenjamin Pre-term labour, could it be predicted? Pre-term labour (PTL) is defined as labour less than 37 completed weeks or 259 days. 15 million PT babies are delivered annually worldwide with a global rate of about 11% with rising trends in most countries. This represents a serious health and economic challenge. The objective of early prediction of PTL is to Identify women at risk so, delaying preterm birth by Interventions long enough to optimize the outcome for the fetus. Prediction could be done by: -Pre-conceptual/early prenatal evaluation - Prenatal Ultrasound markers - Biomarker predictors Highlights on diagnosing PTL for women with intact membranes and preterm prelabour rupture of membranes (P-PROM) will be presented plus recommended prophylactic interventions as prophylactic vaginal progesterone, prophylactic cervical cerclage & 'Rescue' cervical cerclage. Treatment essentials of PTL include tocolysis, maternal corticosteroids & Magnesium Sulphate. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/pre-termlabour-220523090349-cc403a54-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Pre-term labour, could it be predicted? Pre-term labour (PTL) is defined as labour less than 37 completed weeks or 259 days. 15 million PT babies are delivered annually worldwide with a global rate of about 11% with rising trends in most countries. This represents a serious health and economic challenge. The objective of early prediction of PTL is to Identify women at risk so, delaying preterm birth by Interventions long enough to optimize the outcome for the fetus. Prediction could be done by: -Pre-conceptual/early prenatal evaluation - Prenatal Ultrasound markers - Biomarker predictors Highlights on diagnosing PTL for women with intact membranes and preterm prelabour rupture of membranes (P-PROM) will be presented plus recommended prophylactic interventions as prophylactic vaginal progesterone, prophylactic cervical cerclage &amp; &#39;Rescue&#39; cervical cerclage. Treatment essentials of PTL include tocolysis, maternal corticosteroids &amp; Magnesium Sulphate.
Pre-term labour.pptx from Wafaa Benjamin
]]>
250 0 https://cdn.slidesharecdn.com/ss_thumbnails/pre-termlabour-220523090349-cc403a54-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
CTG Interpretation .pptx /slideshow/ctg-interpretation-pptx/251836192 ctginterpretation-220523080547-5d3b686e
CTG Interpretation, evidence based approach Cardiotocography (CTG) or electronic fetal monitoring (EFM) is the most widely used technique for assessing fetal wellbeing in labour in the developed world. The primary purpose of fetal surveillance by CTG is to prevent adverse fetal outcomes. Continuous electronic foetal monitoring is recommended to assure fetal wellbeing in labour in high risk pregnant women. Understanding pathophysiology of fetal heart rate variation will help appropriate interpretation of the CTG. Features & classification of CTG according to RCOG will be demonstrated in this presentation with sufficient trace demonstration. ]]>

CTG Interpretation, evidence based approach Cardiotocography (CTG) or electronic fetal monitoring (EFM) is the most widely used technique for assessing fetal wellbeing in labour in the developed world. The primary purpose of fetal surveillance by CTG is to prevent adverse fetal outcomes. Continuous electronic foetal monitoring is recommended to assure fetal wellbeing in labour in high risk pregnant women. Understanding pathophysiology of fetal heart rate variation will help appropriate interpretation of the CTG. Features & classification of CTG according to RCOG will be demonstrated in this presentation with sufficient trace demonstration. ]]>
Mon, 23 May 2022 08:05:47 GMT /slideshow/ctg-interpretation-pptx/251836192 wafaabenjamin@slideshare.net(wafaabenjamin) CTG Interpretation .pptx wafaabenjamin CTG Interpretation, evidence based approach Cardiotocography (CTG) or electronic fetal monitoring (EFM) is the most widely used technique for assessing fetal wellbeing in labour in the developed world. The primary purpose of fetal surveillance by CTG is to prevent adverse fetal outcomes. Continuous electronic foetal monitoring is recommended to assure fetal wellbeing in labour in high risk pregnant women. Understanding pathophysiology of fetal heart rate variation will help appropriate interpretation of the CTG. Features & classification of CTG according to RCOG will be demonstrated in this presentation with sufficient trace demonstration. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/ctginterpretation-220523080547-5d3b686e-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> CTG Interpretation, evidence based approach Cardiotocography (CTG) or electronic fetal monitoring (EFM) is the most widely used technique for assessing fetal wellbeing in labour in the developed world. The primary purpose of fetal surveillance by CTG is to prevent adverse fetal outcomes. Continuous electronic foetal monitoring is recommended to assure fetal wellbeing in labour in high risk pregnant women. Understanding pathophysiology of fetal heart rate variation will help appropriate interpretation of the CTG. Features &amp; classification of CTG according to RCOG will be demonstrated in this presentation with sufficient trace demonstration.
CTG Interpretation .pptx from Wafaa Benjamin
]]>
10179 0 https://cdn.slidesharecdn.com/ss_thumbnails/ctginterpretation-220523080547-5d3b686e-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
obstetric and gynaecological management with breast cancer .pptx /slideshow/obstetric-and-gynaecological-management-with-breast-cancer-pptx/251835561 obstetricandgynaecologicalmanagementwithbreastcancer-220523064702-08504638
Obstetric & Gynaecological Management with Breast Cancer Breast cancer is the most common cancer in females worldwide. It increasingly affects women through their reproductive age. The prognosis of breast cancer is improving, with 5-year survival 80% ( >50years(. As a result, obstetrician and gynaecologists are nowadays facing more women who are: â—¦ Diagnosed with breast cancer during pregnancy â—¦ Coming for Pre-pregnancy counselling following breast cancer treatment â—¦ Asking for fertility preservation with breast cancer â—¦ Having a Genetic predisposition to breast cancer On this presentation I am going to address those problems in clinical case scenarios in line with latest evidences. ]]>

Obstetric & Gynaecological Management with Breast Cancer Breast cancer is the most common cancer in females worldwide. It increasingly affects women through their reproductive age. The prognosis of breast cancer is improving, with 5-year survival 80% ( >50years(. As a result, obstetrician and gynaecologists are nowadays facing more women who are: â—¦ Diagnosed with breast cancer during pregnancy â—¦ Coming for Pre-pregnancy counselling following breast cancer treatment â—¦ Asking for fertility preservation with breast cancer â—¦ Having a Genetic predisposition to breast cancer On this presentation I am going to address those problems in clinical case scenarios in line with latest evidences. ]]>
Mon, 23 May 2022 06:47:02 GMT /slideshow/obstetric-and-gynaecological-management-with-breast-cancer-pptx/251835561 wafaabenjamin@slideshare.net(wafaabenjamin) obstetric and gynaecological management with breast cancer .pptx wafaabenjamin Obstetric & Gynaecological Management with Breast Cancer Breast cancer is the most common cancer in females worldwide. It increasingly affects women through their reproductive age. The prognosis of breast cancer is improving, with 5-year survival 80% ( >50years(. As a result, obstetrician and gynaecologists are nowadays facing more women who are: â—¦ Diagnosed with breast cancer during pregnancy â—¦ Coming for Pre-pregnancy counselling following breast cancer treatment â—¦ Asking for fertility preservation with breast cancer â—¦ Having a Genetic predisposition to breast cancer On this presentation I am going to address those problems in clinical case scenarios in line with latest evidences. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/obstetricandgynaecologicalmanagementwithbreastcancer-220523064702-08504638-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Obstetric &amp; Gynaecological Management with Breast Cancer Breast cancer is the most common cancer in females worldwide. It increasingly affects women through their reproductive age. The prognosis of breast cancer is improving, with 5-year survival 80% ( &gt;50years(. As a result, obstetrician and gynaecologists are nowadays facing more women who are: â—¦ Diagnosed with breast cancer during pregnancy â—¦ Coming for Pre-pregnancy counselling following breast cancer treatment â—¦ Asking for fertility preservation with breast cancer â—¦ Having a Genetic predisposition to breast cancer On this presentation I am going to address those problems in clinical case scenarios in line with latest evidences.
obstetric and gynaecological management with breast cancer .pptx from Wafaa Benjamin
]]>
176 0 https://cdn.slidesharecdn.com/ss_thumbnails/obstetricandgynaecologicalmanagementwithbreastcancer-220523064702-08504638-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Adolescent pregnancy adverse effects /slideshow/adolescent-pregnancy-adverse-effects/121236836 adolescentpregnancyadverseeffects-181030212214
Teenagers are at risk of a range of adverse pregnancy outcomes, particularly preterm birth. The reasons for this are complex and reflect a combination of adverse socioeconomic pressures and gynaecological and biological immaturity. The obstetrician providing care for women in this age group should be aware of the potential challenges. Studies have shown that delaying adolescent births could significantly lower population growth rates, potentially generating broad economic and social benefits, in addition to improving the health of adolescents. A national target should be set to decrease the incidence of teenage pregnancy in our country . Obstetricians should have a major role in such health education. ,]]>

Teenagers are at risk of a range of adverse pregnancy outcomes, particularly preterm birth. The reasons for this are complex and reflect a combination of adverse socioeconomic pressures and gynaecological and biological immaturity. The obstetrician providing care for women in this age group should be aware of the potential challenges. Studies have shown that delaying adolescent births could significantly lower population growth rates, potentially generating broad economic and social benefits, in addition to improving the health of adolescents. A national target should be set to decrease the incidence of teenage pregnancy in our country . Obstetricians should have a major role in such health education. ,]]>
Tue, 30 Oct 2018 21:22:14 GMT /slideshow/adolescent-pregnancy-adverse-effects/121236836 wafaabenjamin@slideshare.net(wafaabenjamin) Adolescent pregnancy adverse effects wafaabenjamin Teenagers are at risk of a range of adverse pregnancy outcomes, particularly preterm birth. The reasons for this are complex and reflect a combination of adverse socioeconomic pressures and gynaecological and biological immaturity. The obstetrician providing care for women in this age group should be aware of the potential challenges. Studies have shown that delaying adolescent births could significantly lower population growth rates, potentially generating broad economic and social benefits, in addition to improving the health of adolescents. A national target should be set to decrease the incidence of teenage pregnancy in our country . Obstetricians should have a major role in such health education. , <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/adolescentpregnancyadverseeffects-181030212214-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Teenagers are at risk of a range of adverse pregnancy outcomes, particularly preterm birth. The reasons for this are complex and reflect a combination of adverse socioeconomic pressures and gynaecological and biological immaturity. The obstetrician providing care for women in this age group should be aware of the potential challenges. Studies have shown that delaying adolescent births could significantly lower population growth rates, potentially generating broad economic and social benefits, in addition to improving the health of adolescents. A national target should be set to decrease the incidence of teenage pregnancy in our country . Obstetricians should have a major role in such health education. ,
Adolescent pregnancy adverse effects from Wafaa Benjamin
]]>
3019 5 https://cdn.slidesharecdn.com/ss_thumbnails/adolescentpregnancyadverseeffects-181030212214-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Woman results-presentation /slideshow/woman-resultspresentation/121236577 woman-results-presentation-181030211703
tranexamic acid in postpartum hemorrhage : Reduces death due to bleeding overall by one fifth Reduces death due to bleeding within 3 hours by about one third No effect on other causes of death Did not reduce hysterectomy Reduces laparotomy for bleeding by over 35% No evidence of adverse effects acid in post-partum hemorrhage ]]>

tranexamic acid in postpartum hemorrhage : Reduces death due to bleeding overall by one fifth Reduces death due to bleeding within 3 hours by about one third No effect on other causes of death Did not reduce hysterectomy Reduces laparotomy for bleeding by over 35% No evidence of adverse effects acid in post-partum hemorrhage ]]>
Tue, 30 Oct 2018 21:17:03 GMT /slideshow/woman-resultspresentation/121236577 wafaabenjamin@slideshare.net(wafaabenjamin) Woman results-presentation wafaabenjamin tranexamic acid in postpartum hemorrhage : Reduces death due to bleeding overall by one fifth Reduces death due to bleeding within 3 hours by about one third No effect on other causes of death Did not reduce hysterectomy Reduces laparotomy for bleeding by over 35% No evidence of adverse effects acid in post-partum hemorrhage <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/woman-results-presentation-181030211703-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> tranexamic acid in postpartum hemorrhage : Reduces death due to bleeding overall by one fifth Reduces death due to bleeding within 3 hours by about one third No effect on other causes of death Did not reduce hysterectomy Reduces laparotomy for bleeding by over 35% No evidence of adverse effects acid in post-partum hemorrhage
Woman results-presentation from Wafaa Benjamin
]]>
206 2 https://cdn.slidesharecdn.com/ss_thumbnails/woman-results-presentation-181030211703-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Training in ob/gyn post in Egypt final /slideshow/training-in-obgyn-post-in-egypt-final/121235691 traininginobgynpostinegyptfinal-181030205722
Recommendation for implementation at national level: Need for uniform training program. Develop curriculum Consultant lead training. TOT courses, (electronic training) Yearly appraisal for trainers . Yearly assessment of trainees (In depth workplace assessment of trainees) Obligatory Courses: basic & advanced Offer simulators, videos. Revise obstacles at hospitals Investigate workload & no of trainees at hospitals. ]]>

Recommendation for implementation at national level: Need for uniform training program. Develop curriculum Consultant lead training. TOT courses, (electronic training) Yearly appraisal for trainers . Yearly assessment of trainees (In depth workplace assessment of trainees) Obligatory Courses: basic & advanced Offer simulators, videos. Revise obstacles at hospitals Investigate workload & no of trainees at hospitals. ]]>
Tue, 30 Oct 2018 20:57:22 GMT /slideshow/training-in-obgyn-post-in-egypt-final/121235691 wafaabenjamin@slideshare.net(wafaabenjamin) Training in ob/gyn post in Egypt final wafaabenjamin Recommendation for implementation at national level: Need for uniform training program. Develop curriculum Consultant lead training. TOT courses, (electronic training) Yearly appraisal for trainers . Yearly assessment of trainees (In depth workplace assessment of trainees) Obligatory Courses: basic & advanced Offer simulators, videos. Revise obstacles at hospitals Investigate workload & no of trainees at hospitals. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/traininginobgynpostinegyptfinal-181030205722-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Recommendation for implementation at national level: Need for uniform training program. Develop curriculum Consultant lead training. TOT courses, (electronic training) Yearly appraisal for trainers . Yearly assessment of trainees (In depth workplace assessment of trainees) Obligatory Courses: basic &amp; advanced Offer simulators, videos. Revise obstacles at hospitals Investigate workload &amp; no of trainees at hospitals.
Training in ob/gyn post in Egypt final from Wafaa Benjamin
]]>
193 1 https://cdn.slidesharecdn.com/ss_thumbnails/traininginobgynpostinegyptfinal-181030205722-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Iron deficiency anaemia in pregnancy- evidence based approach /slideshow/iron-deficiency-anaemia-in-pregnancy-evidence-based-approach/121235082 irondefanaemia-final-181030204502
Iron deficiency is the most common deficiency state in the world, affecting more than 2 billion people globally. Iron Depletion affects 20-40% of Egyptian women in childbearing period. Effective management is needed to prevent adverse maternal and pregnancy outcomes, including the need for red cell transfusion. There should be clear and simple recommendations for the diagnosis, treatment and prevention of iron deficiency in pregnancy and the postpartum period. Universal iron supplementation in pregnancy is more suitable for our local protocol. Haemoglopinopathy screening program for pregnant women is awaited. ]]>

Iron deficiency is the most common deficiency state in the world, affecting more than 2 billion people globally. Iron Depletion affects 20-40% of Egyptian women in childbearing period. Effective management is needed to prevent adverse maternal and pregnancy outcomes, including the need for red cell transfusion. There should be clear and simple recommendations for the diagnosis, treatment and prevention of iron deficiency in pregnancy and the postpartum period. Universal iron supplementation in pregnancy is more suitable for our local protocol. Haemoglopinopathy screening program for pregnant women is awaited. ]]>
Tue, 30 Oct 2018 20:45:02 GMT /slideshow/iron-deficiency-anaemia-in-pregnancy-evidence-based-approach/121235082 wafaabenjamin@slideshare.net(wafaabenjamin) Iron deficiency anaemia in pregnancy- evidence based approach wafaabenjamin Iron deficiency is the most common deficiency state in the world, affecting more than 2 billion people globally. Iron Depletion affects 20-40% of Egyptian women in childbearing period. Effective management is needed to prevent adverse maternal and pregnancy outcomes, including the need for red cell transfusion. There should be clear and simple recommendations for the diagnosis, treatment and prevention of iron deficiency in pregnancy and the postpartum period. Universal iron supplementation in pregnancy is more suitable for our local protocol. Haemoglopinopathy screening program for pregnant women is awaited. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/irondefanaemia-final-181030204502-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Iron deficiency is the most common deficiency state in the world, affecting more than 2 billion people globally. Iron Depletion affects 20-40% of Egyptian women in childbearing period. Effective management is needed to prevent adverse maternal and pregnancy outcomes, including the need for red cell transfusion. There should be clear and simple recommendations for the diagnosis, treatment and prevention of iron deficiency in pregnancy and the postpartum period. Universal iron supplementation in pregnancy is more suitable for our local protocol. Haemoglopinopathy screening program for pregnant women is awaited.
Iron deficiency anaemia in pregnancy- evidence based approach from Wafaa Benjamin
]]>
1449 4 https://cdn.slidesharecdn.com/ss_thumbnails/irondefanaemia-final-181030204502-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
The use of algorithms & emergency boxes in obstetric emergency /wafaabenjamin/the-use-of-algorithms-emergency-boxes-in-obstetric-emergency theuseofalgorithmsemergencyboxesinobstetricemergency-181030202532
obstetric hemorrhage Is the major cause of maternal mortality globally. Substandard management identified as a contributor for maternal mortality in UK in 80% of the cases. Is the major cause of mortality in Egypt ,according to the last Egyptian Maternal Mortality Report in 2001. So we need to Work in a team, Do all needed steps, In the proper sequence of the steps, competent emergency team should have Knowledge ,Skills , Attitude & exposed to regular Labor Ward drills. Ready available Algorithms & Emergency Boxes are found to be helpful in emergency situations. ]]>

obstetric hemorrhage Is the major cause of maternal mortality globally. Substandard management identified as a contributor for maternal mortality in UK in 80% of the cases. Is the major cause of mortality in Egypt ,according to the last Egyptian Maternal Mortality Report in 2001. So we need to Work in a team, Do all needed steps, In the proper sequence of the steps, competent emergency team should have Knowledge ,Skills , Attitude & exposed to regular Labor Ward drills. Ready available Algorithms & Emergency Boxes are found to be helpful in emergency situations. ]]>
Tue, 30 Oct 2018 20:25:32 GMT /wafaabenjamin/the-use-of-algorithms-emergency-boxes-in-obstetric-emergency wafaabenjamin@slideshare.net(wafaabenjamin) The use of algorithms & emergency boxes in obstetric emergency wafaabenjamin obstetric hemorrhage Is the major cause of maternal mortality globally. Substandard management identified as a contributor for maternal mortality in UK in 80% of the cases. Is the major cause of mortality in Egypt ,according to the last Egyptian Maternal Mortality Report in 2001. So we need to Work in a team, Do all needed steps, In the proper sequence of the steps, competent emergency team should have Knowledge ,Skills , Attitude & exposed to regular Labor Ward drills. Ready available Algorithms & Emergency Boxes are found to be helpful in emergency situations. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/theuseofalgorithmsemergencyboxesinobstetricemergency-181030202532-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> obstetric hemorrhage Is the major cause of maternal mortality globally. Substandard management identified as a contributor for maternal mortality in UK in 80% of the cases. Is the major cause of mortality in Egypt ,according to the last Egyptian Maternal Mortality Report in 2001. So we need to Work in a team, Do all needed steps, In the proper sequence of the steps, competent emergency team should have Knowledge ,Skills , Attitude &amp; exposed to regular Labor Ward drills. Ready available Algorithms &amp; Emergency Boxes are found to be helpful in emergency situations.
The use of algorithms & emergency boxes in obstetric emergency from Wafaa Benjamin
]]>
654 3 https://cdn.slidesharecdn.com/ss_thumbnails/theuseofalgorithmsemergencyboxesinobstetricemergency-181030202532-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Recurrent urinary tract infection-Evidence based approach /wafaabenjamin/recurrent-urinary-tract-infectionevidence-based-approach recurrenturinarytract-181030201859
Recurrent UTI is a common problem encountered in many areas of clinical practice. It is a cause of significant morbidity: urinary infection is one of the commonest indications for antibiotic prescription in community and hospital settings. The majority of cases are uncomplicated and respond rapidly to appropriate treatment.  In the management of women with any type of UTI, it is important to have an appreciation of the pathogenesis, host and bacterial interaction, methods of diagnosis, treatment algorithms and local antibiotic sensitivities.  It should be remembered that 20-30% of women with UTI develop at least one recurrent infection ]]>

Recurrent UTI is a common problem encountered in many areas of clinical practice. It is a cause of significant morbidity: urinary infection is one of the commonest indications for antibiotic prescription in community and hospital settings. The majority of cases are uncomplicated and respond rapidly to appropriate treatment.  In the management of women with any type of UTI, it is important to have an appreciation of the pathogenesis, host and bacterial interaction, methods of diagnosis, treatment algorithms and local antibiotic sensitivities.  It should be remembered that 20-30% of women with UTI develop at least one recurrent infection ]]>
Tue, 30 Oct 2018 20:18:59 GMT /wafaabenjamin/recurrent-urinary-tract-infectionevidence-based-approach wafaabenjamin@slideshare.net(wafaabenjamin) Recurrent urinary tract infection-Evidence based approach wafaabenjamin Recurrent UTI is a common problem encountered in many areas of clinical practice. It is a cause of significant morbidity: urinary infection is one of the commonest indications for antibiotic prescription in community and hospital settings. The majority of cases are uncomplicated and respond rapidly to appropriate treatment.  In the management of women with any type of UTI, it is important to have an appreciation of the pathogenesis, host and bacterial interaction, methods of diagnosis, treatment algorithms and local antibiotic sensitivities.  It should be remembered that 20-30% of women with UTI develop at least one recurrent infection <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/recurrenturinarytract-181030201859-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Recurrent UTI is a common problem encountered in many areas of clinical practice. It is a cause of significant morbidity: urinary infection is one of the commonest indications for antibiotic prescription in community and hospital settings. The majority of cases are uncomplicated and respond rapidly to appropriate treatment.  In the management of women with any type of UTI, it is important to have an appreciation of the pathogenesis, host and bacterial interaction, methods of diagnosis, treatment algorithms and local antibiotic sensitivities.  It should be remembered that 20-30% of women with UTI develop at least one recurrent infection
Recurrent urinary tract infection-Evidence based approach from Wafaa Benjamin
]]>
1094 6 https://cdn.slidesharecdn.com/ss_thumbnails/recurrenturinarytract-181030201859-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Management of SLE with pregnancy ,the difficult mission /slideshow/management-of-sle-with-pregnancy-the-difficult-mission/121232236 sleainshams-181030195547
Involvement of obstetricians and physicians with experience of managing SLE in pregnancy improves the outcome for the mother and foetus. MDT Pre-pregnancy clinics Triage of low& high risk women Be alert to detect a flare Wait for PE & distinguish from L.nephritis TOP when in risk ]]>

Involvement of obstetricians and physicians with experience of managing SLE in pregnancy improves the outcome for the mother and foetus. MDT Pre-pregnancy clinics Triage of low& high risk women Be alert to detect a flare Wait for PE & distinguish from L.nephritis TOP when in risk ]]>
Tue, 30 Oct 2018 19:55:47 GMT /slideshow/management-of-sle-with-pregnancy-the-difficult-mission/121232236 wafaabenjamin@slideshare.net(wafaabenjamin) Management of SLE with pregnancy ,the difficult mission wafaabenjamin Involvement of obstetricians and physicians with experience of managing SLE in pregnancy improves the outcome for the mother and foetus. MDT Pre-pregnancy clinics Triage of low& high risk women Be alert to detect a flare Wait for PE & distinguish from L.nephritis TOP when in risk <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/sleainshams-181030195547-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Involvement of obstetricians and physicians with experience of managing SLE in pregnancy improves the outcome for the mother and foetus. MDT Pre-pregnancy clinics Triage of low&amp; high risk women Be alert to detect a flare Wait for PE &amp; distinguish from L.nephritis TOP when in risk
Management of SLE with pregnancy ,the difficult mission from Wafaa Benjamin
]]>
998 6 https://cdn.slidesharecdn.com/ss_thumbnails/sleainshams-181030195547-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Investigations for iufd & sb, how to select? /slideshow/investigations-for-iufd-sb-how-to-select/121228824 investigationsforiufdsbhowtoselect-181030190505
Foetal loss is a distressing situation for the lady ,family and medical staff as well. Investigating the cause of death has many benefits . Meticulous history taking and clinical assessment is of at most importance. There are routine standard tests & others arte selective directed by clinical scenarios. Researches & recording are required to estimate main causes of foetal death at local level, so, investigations could be directed. In presence of lack of resources, selection of investigations should be prioritized by most relevant and most informative ones. Post-mortem examination should be re-included at least external examination & placental histopathology. ]]>

Foetal loss is a distressing situation for the lady ,family and medical staff as well. Investigating the cause of death has many benefits . Meticulous history taking and clinical assessment is of at most importance. There are routine standard tests & others arte selective directed by clinical scenarios. Researches & recording are required to estimate main causes of foetal death at local level, so, investigations could be directed. In presence of lack of resources, selection of investigations should be prioritized by most relevant and most informative ones. Post-mortem examination should be re-included at least external examination & placental histopathology. ]]>
Tue, 30 Oct 2018 19:05:05 GMT /slideshow/investigations-for-iufd-sb-how-to-select/121228824 wafaabenjamin@slideshare.net(wafaabenjamin) Investigations for iufd & sb, how to select? wafaabenjamin Foetal loss is a distressing situation for the lady ,family and medical staff as well. Investigating the cause of death has many benefits . Meticulous history taking and clinical assessment is of at most importance. There are routine standard tests & others arte selective directed by clinical scenarios. Researches & recording are required to estimate main causes of foetal death at local level, so, investigations could be directed. In presence of lack of resources, selection of investigations should be prioritized by most relevant and most informative ones. Post-mortem examination should be re-included at least external examination & placental histopathology. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/investigationsforiufdsbhowtoselect-181030190505-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Foetal loss is a distressing situation for the lady ,family and medical staff as well. Investigating the cause of death has many benefits . Meticulous history taking and clinical assessment is of at most importance. There are routine standard tests &amp; others arte selective directed by clinical scenarios. Researches &amp; recording are required to estimate main causes of foetal death at local level, so, investigations could be directed. In presence of lack of resources, selection of investigations should be prioritized by most relevant and most informative ones. Post-mortem examination should be re-included at least external examination &amp; placental histopathology.
Investigations for iufd & sb, how to select? from Wafaa Benjamin
]]>
854 5 https://cdn.slidesharecdn.com/ss_thumbnails/investigationsforiufdsbhowtoselect-181030190505-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
How evidence affects clinical practice in egypt /slideshow/how-evidence-affects-clinical-practice-in-egypt/121227706 howevidenceaffectsclinicalpracticeinegypt-181030185337
Evidence ­based medicine is the gold standard for clinical care. It implies the integration of best research evidence with clinical expertise and patient values. There is still a wide gap between availability of evidence and its incorporation into routine practice in our country. Barriers to implementation could be personal, social, institutional, financial and legal barriers. True practice of evidence ­based care can only occur where evidence­ based decisions coincide with patients’ beliefs and clinicians’ preferences. Continuing medical education programs should be set with integrating evidence ­based medicine teaching and learning within clinical training. The importance of presence of local national guidelines which need to take into account variation in expertise, resources and patient preferences across our geographical and cultural contexts . Customisation of a guideline to meet the local needs of a target patient population is critical to successful implementation. ]]>

Evidence ­based medicine is the gold standard for clinical care. It implies the integration of best research evidence with clinical expertise and patient values. There is still a wide gap between availability of evidence and its incorporation into routine practice in our country. Barriers to implementation could be personal, social, institutional, financial and legal barriers. True practice of evidence ­based care can only occur where evidence­ based decisions coincide with patients’ beliefs and clinicians’ preferences. Continuing medical education programs should be set with integrating evidence ­based medicine teaching and learning within clinical training. The importance of presence of local national guidelines which need to take into account variation in expertise, resources and patient preferences across our geographical and cultural contexts . Customisation of a guideline to meet the local needs of a target patient population is critical to successful implementation. ]]>
Tue, 30 Oct 2018 18:53:37 GMT /slideshow/how-evidence-affects-clinical-practice-in-egypt/121227706 wafaabenjamin@slideshare.net(wafaabenjamin) How evidence affects clinical practice in egypt wafaabenjamin Evidence ­based medicine is the gold standard for clinical care. It implies the integration of best research evidence with clinical expertise and patient values. There is still a wide gap between availability of evidence and its incorporation into routine practice in our country. Barriers to implementation could be personal, social, institutional, financial and legal barriers. True practice of evidence ­based care can only occur where evidence­ based decisions coincide with patients’ beliefs and clinicians’ preferences. Continuing medical education programs should be set with integrating evidence ­based medicine teaching and learning within clinical training. The importance of presence of local national guidelines which need to take into account variation in expertise, resources and patient preferences across our geographical and cultural contexts . Customisation of a guideline to meet the local needs of a target patient population is critical to successful implementation. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/howevidenceaffectsclinicalpracticeinegypt-181030185337-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Evidence ­based medicine is the gold standard for clinical care. It implies the integration of best research evidence with clinical expertise and patient values. There is still a wide gap between availability of evidence and its incorporation into routine practice in our country. Barriers to implementation could be personal, social, institutional, financial and legal barriers. True practice of evidence ­based care can only occur where evidence­ based decisions coincide with patients’ beliefs and clinicians’ preferences. Continuing medical education programs should be set with integrating evidence ­based medicine teaching and learning within clinical training. The importance of presence of local national guidelines which need to take into account variation in expertise, resources and patient preferences across our geographical and cultural contexts . Customisation of a guideline to meet the local needs of a target patient population is critical to successful implementation.
How evidence affects clinical practice in egypt from Wafaa Benjamin
]]>
116 1 https://cdn.slidesharecdn.com/ss_thumbnails/howevidenceaffectsclinicalpracticeinegypt-181030185337-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Obesity & endometrial cancer /slideshow/obesity-amp-endometrial-cancer/121222886 obesityendometrialcancer-181030180840
Obesity is now clearly established as a major risk factor for endometrial cancer. In medium income country like ours , Obesity prevention and lifestyle initiatives should become the responsibility of public health services. Stepwise programmes with realistic time-related goals are required, starting with modification of lifestyle, progressing to pharmacotherapy and ultimately obesity surgery. The real challenge now is to triage those women at a higher risk and offer them prophylactic measures as COCPs ,DMPA, oral progesterone or Mirena coil. Standard treatment for endometrial cancer is surgery. Obesity is associated with numerous disorders which put the patient at increase risk of peri-operative complications that require more detailed pre-operative assessment and more intensive post-operative care. Thus treatment for endometrial cancer needs to be reassessed in the complex and increasingly common situation of the obese, older women with this disease. ]]>

Obesity is now clearly established as a major risk factor for endometrial cancer. In medium income country like ours , Obesity prevention and lifestyle initiatives should become the responsibility of public health services. Stepwise programmes with realistic time-related goals are required, starting with modification of lifestyle, progressing to pharmacotherapy and ultimately obesity surgery. The real challenge now is to triage those women at a higher risk and offer them prophylactic measures as COCPs ,DMPA, oral progesterone or Mirena coil. Standard treatment for endometrial cancer is surgery. Obesity is associated with numerous disorders which put the patient at increase risk of peri-operative complications that require more detailed pre-operative assessment and more intensive post-operative care. Thus treatment for endometrial cancer needs to be reassessed in the complex and increasingly common situation of the obese, older women with this disease. ]]>
Tue, 30 Oct 2018 18:08:40 GMT /slideshow/obesity-amp-endometrial-cancer/121222886 wafaabenjamin@slideshare.net(wafaabenjamin) Obesity & endometrial cancer wafaabenjamin Obesity is now clearly established as a major risk factor for endometrial cancer. In medium income country like ours , Obesity prevention and lifestyle initiatives should become the responsibility of public health services. Stepwise programmes with realistic time-related goals are required, starting with modification of lifestyle, progressing to pharmacotherapy and ultimately obesity surgery. The real challenge now is to triage those women at a higher risk and offer them prophylactic measures as COCPs ,DMPA, oral progesterone or Mirena coil. Standard treatment for endometrial cancer is surgery. Obesity is associated with numerous disorders which put the patient at increase risk of peri-operative complications that require more detailed pre-operative assessment and more intensive post-operative care. Thus treatment for endometrial cancer needs to be reassessed in the complex and increasingly common situation of the obese, older women with this disease. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/obesityendometrialcancer-181030180840-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Obesity is now clearly established as a major risk factor for endometrial cancer. In medium income country like ours , Obesity prevention and lifestyle initiatives should become the responsibility of public health services. Stepwise programmes with realistic time-related goals are required, starting with modification of lifestyle, progressing to pharmacotherapy and ultimately obesity surgery. The real challenge now is to triage those women at a higher risk and offer them prophylactic measures as COCPs ,DMPA, oral progesterone or Mirena coil. Standard treatment for endometrial cancer is surgery. Obesity is associated with numerous disorders which put the patient at increase risk of peri-operative complications that require more detailed pre-operative assessment and more intensive post-operative care. Thus treatment for endometrial cancer needs to be reassessed in the complex and increasingly common situation of the obese, older women with this disease.
Obesity & endometrial cancer from Wafaa Benjamin
]]>
340 11 https://cdn.slidesharecdn.com/ss_thumbnails/obesityendometrialcancer-181030180840-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Vulval skin disorders /slideshow/vulval-skin-disorders/121221051 vulvalskindisorders-181030174702
Pruritus vulvae and vulval pain are very common complaints and most women initially self medicate. Although it is often self­limiting, chronic vulval pruritus suggests an underlying vulval dermatosis. Careful and systemic examination is fundamental to making a diagnosis. Skin biopsies are not always necessary but are essential if VIN or invasive disease is suspected or if the condition does not respond to treatment. General care of vulval skin is a fundamental component of treatment.Avoidance of potential irritants will benefit most conditions. The mainstay of the management of lichen sclerosus is topical ultrapotent steroids. Women require clear advice on the appropriate treatment regimes. Women with VIN require a biopsy to confirm disease.Long­term surveillance is necessary, particularly when a medical or conservative approach to management is taken. All gynaecological trainees require experience in the management of common skin disorders, but a specialist service improves care for women by improving the accuracy of diagnosis and the implementation of adequate and appropriate treatment. ]]>

Pruritus vulvae and vulval pain are very common complaints and most women initially self medicate. Although it is often self­limiting, chronic vulval pruritus suggests an underlying vulval dermatosis. Careful and systemic examination is fundamental to making a diagnosis. Skin biopsies are not always necessary but are essential if VIN or invasive disease is suspected or if the condition does not respond to treatment. General care of vulval skin is a fundamental component of treatment.Avoidance of potential irritants will benefit most conditions. The mainstay of the management of lichen sclerosus is topical ultrapotent steroids. Women require clear advice on the appropriate treatment regimes. Women with VIN require a biopsy to confirm disease.Long­term surveillance is necessary, particularly when a medical or conservative approach to management is taken. All gynaecological trainees require experience in the management of common skin disorders, but a specialist service improves care for women by improving the accuracy of diagnosis and the implementation of adequate and appropriate treatment. ]]>
Tue, 30 Oct 2018 17:47:02 GMT /slideshow/vulval-skin-disorders/121221051 wafaabenjamin@slideshare.net(wafaabenjamin) Vulval skin disorders wafaabenjamin Pruritus vulvae and vulval pain are very common complaints and most women initially self medicate. Although it is often self­limiting, chronic vulval pruritus suggests an underlying vulval dermatosis. Careful and systemic examination is fundamental to making a diagnosis. Skin biopsies are not always necessary but are essential if VIN or invasive disease is suspected or if the condition does not respond to treatment. General care of vulval skin is a fundamental component of treatment.Avoidance of potential irritants will benefit most conditions. The mainstay of the management of lichen sclerosus is topical ultrapotent steroids. Women require clear advice on the appropriate treatment regimes. Women with VIN require a biopsy to confirm disease.Long­term surveillance is necessary, particularly when a medical or conservative approach to management is taken. All gynaecological trainees require experience in the management of common skin disorders, but a specialist service improves care for women by improving the accuracy of diagnosis and the implementation of adequate and appropriate treatment. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/vulvalskindisorders-181030174702-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Pruritus vulvae and vulval pain are very common complaints and most women initially self medicate. Although it is often self­limiting, chronic vulval pruritus suggests an underlying vulval dermatosis. Careful and systemic examination is fundamental to making a diagnosis. Skin biopsies are not always necessary but are essential if VIN or invasive disease is suspected or if the condition does not respond to treatment. General care of vulval skin is a fundamental component of treatment.Avoidance of potential irritants will benefit most conditions. The mainstay of the management of lichen sclerosus is topical ultrapotent steroids. Women require clear advice on the appropriate treatment regimes. Women with VIN require a biopsy to confirm disease.Long­term surveillance is necessary, particularly when a medical or conservative approach to management is taken. All gynaecological trainees require experience in the management of common skin disorders, but a specialist service improves care for women by improving the accuracy of diagnosis and the implementation of adequate and appropriate treatment.
Vulval skin disorders from Wafaa Benjamin
]]>
7952 9 https://cdn.slidesharecdn.com/ss_thumbnails/vulvalskindisorders-181030174702-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Manegement of adenexal masses in pregnancy /slideshow/manegement-of-adenexal-masses-in-pregnancy/121217890 manegementofadenexalmassesinpregnancy-181030171158
Over the last 20 years, the use of ultrasound in pregnancy has dramatically increased the numbers of ovarian cysts diagnosed. The majority of these ovarian cysts in pregnancy either resolve spontaneously or are due to benign conditions. Ovarian cancer is extremely rare in women of childbearing age and thus most of these cysts can be managed conservatively. In terms of malignancy potential, those that are malignant are likely to be borderline. Unless there is a suspicion of malignancy or there is a significant cyst complication, such as torsion, surgery is not indicated. MRI is a safe and useful tool to help evaluate cysts in more detail in situations where ultrasound provides an inconclusive answer. If surgery is planned, this should take place during the second trimester to minimise the risk of miscarriage. Whether surgery is done laparoscopically or using a traditional open approach, it is largely dependent on operator experience and patient preference. Aspiration of ovarian cysts is only indicated where they appear simple on ultrasound and where they are causing pain or are thought to be obstructing the birth canal. If surgery does not take place, then ultrasound follow-up during and after pregnancy may be advised accordingly. ]]>

Over the last 20 years, the use of ultrasound in pregnancy has dramatically increased the numbers of ovarian cysts diagnosed. The majority of these ovarian cysts in pregnancy either resolve spontaneously or are due to benign conditions. Ovarian cancer is extremely rare in women of childbearing age and thus most of these cysts can be managed conservatively. In terms of malignancy potential, those that are malignant are likely to be borderline. Unless there is a suspicion of malignancy or there is a significant cyst complication, such as torsion, surgery is not indicated. MRI is a safe and useful tool to help evaluate cysts in more detail in situations where ultrasound provides an inconclusive answer. If surgery is planned, this should take place during the second trimester to minimise the risk of miscarriage. Whether surgery is done laparoscopically or using a traditional open approach, it is largely dependent on operator experience and patient preference. Aspiration of ovarian cysts is only indicated where they appear simple on ultrasound and where they are causing pain or are thought to be obstructing the birth canal. If surgery does not take place, then ultrasound follow-up during and after pregnancy may be advised accordingly. ]]>
Tue, 30 Oct 2018 17:11:58 GMT /slideshow/manegement-of-adenexal-masses-in-pregnancy/121217890 wafaabenjamin@slideshare.net(wafaabenjamin) Manegement of adenexal masses in pregnancy wafaabenjamin Over the last 20 years, the use of ultrasound in pregnancy has dramatically increased the numbers of ovarian cysts diagnosed. The majority of these ovarian cysts in pregnancy either resolve spontaneously or are due to benign conditions. Ovarian cancer is extremely rare in women of childbearing age and thus most of these cysts can be managed conservatively. In terms of malignancy potential, those that are malignant are likely to be borderline. Unless there is a suspicion of malignancy or there is a significant cyst complication, such as torsion, surgery is not indicated. MRI is a safe and useful tool to help evaluate cysts in more detail in situations where ultrasound provides an inconclusive answer. If surgery is planned, this should take place during the second trimester to minimise the risk of miscarriage. Whether surgery is done laparoscopically or using a traditional open approach, it is largely dependent on operator experience and patient preference. Aspiration of ovarian cysts is only indicated where they appear simple on ultrasound and where they are causing pain or are thought to be obstructing the birth canal. If surgery does not take place, then ultrasound follow-up during and after pregnancy may be advised accordingly. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/manegementofadenexalmassesinpregnancy-181030171158-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Over the last 20 years, the use of ultrasound in pregnancy has dramatically increased the numbers of ovarian cysts diagnosed. The majority of these ovarian cysts in pregnancy either resolve spontaneously or are due to benign conditions. Ovarian cancer is extremely rare in women of childbearing age and thus most of these cysts can be managed conservatively. In terms of malignancy potential, those that are malignant are likely to be borderline. Unless there is a suspicion of malignancy or there is a significant cyst complication, such as torsion, surgery is not indicated. MRI is a safe and useful tool to help evaluate cysts in more detail in situations where ultrasound provides an inconclusive answer. If surgery is planned, this should take place during the second trimester to minimise the risk of miscarriage. Whether surgery is done laparoscopically or using a traditional open approach, it is largely dependent on operator experience and patient preference. Aspiration of ovarian cysts is only indicated where they appear simple on ultrasound and where they are causing pain or are thought to be obstructing the birth canal. If surgery does not take place, then ultrasound follow-up during and after pregnancy may be advised accordingly.
Manegement of adenexal masses in pregnancy from Wafaa Benjamin
]]>
782 2 https://cdn.slidesharecdn.com/ss_thumbnails/manegementofadenexalmassesinpregnancy-181030171158-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
The role of bariatric surgery in the management /slideshow/the-role-of-bariatric-surgery-in-the-management/121216591 theroleofbariatricsurgeryinthemanagement-181030165909
Despite the fact that bariatric surgery does not reduce absolute BMI to within normal range in most patients, studies suggest it improves some important markers of fertility including hyper-insulinemia and ovulation in polycystic ovary syndrome. Moreover, maternal outcomes and morbidity in pregnancy are better than for women who are similarly obese and are comparable with that of the general population. Obese women who have weight loss surgery before becoming pregnant have a lower risk of pregnancy-related health problems and their children are less likely to be born with complications. Life-long vitamin supplementation is advised. It is advised against falling pregnant during the initial weight loss phase (1 year) ]]>

Despite the fact that bariatric surgery does not reduce absolute BMI to within normal range in most patients, studies suggest it improves some important markers of fertility including hyper-insulinemia and ovulation in polycystic ovary syndrome. Moreover, maternal outcomes and morbidity in pregnancy are better than for women who are similarly obese and are comparable with that of the general population. Obese women who have weight loss surgery before becoming pregnant have a lower risk of pregnancy-related health problems and their children are less likely to be born with complications. Life-long vitamin supplementation is advised. It is advised against falling pregnant during the initial weight loss phase (1 year) ]]>
Tue, 30 Oct 2018 16:59:09 GMT /slideshow/the-role-of-bariatric-surgery-in-the-management/121216591 wafaabenjamin@slideshare.net(wafaabenjamin) The role of bariatric surgery in the management wafaabenjamin Despite the fact that bariatric surgery does not reduce absolute BMI to within normal range in most patients, studies suggest it improves some important markers of fertility including hyper-insulinemia and ovulation in polycystic ovary syndrome. Moreover, maternal outcomes and morbidity in pregnancy are better than for women who are similarly obese and are comparable with that of the general population. Obese women who have weight loss surgery before becoming pregnant have a lower risk of pregnancy-related health problems and their children are less likely to be born with complications. Life-long vitamin supplementation is advised. It is advised against falling pregnant during the initial weight loss phase (1 year) <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/theroleofbariatricsurgeryinthemanagement-181030165909-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Despite the fact that bariatric surgery does not reduce absolute BMI to within normal range in most patients, studies suggest it improves some important markers of fertility including hyper-insulinemia and ovulation in polycystic ovary syndrome. Moreover, maternal outcomes and morbidity in pregnancy are better than for women who are similarly obese and are comparable with that of the general population. Obese women who have weight loss surgery before becoming pregnant have a lower risk of pregnancy-related health problems and their children are less likely to be born with complications. Life-long vitamin supplementation is advised. It is advised against falling pregnant during the initial weight loss phase (1 year)
The role of bariatric surgery in the management from Wafaa Benjamin
]]>
614 9 https://cdn.slidesharecdn.com/ss_thumbnails/theroleofbariatricsurgeryinthemanagement-181030165909-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Obesity& reproductive health /slideshow/obesity-reproductive-health/121212276 obesityreproductivehealth-181030162549
Obesity has many deleterious effects for women of reproductive age. In the first place, obese women are more likely to encounter problems becoming pregnant and they are more likely to miscarry They are at greater risk of developing pregnancy complications and problems associated with labour and delivery. Finally, obese women are more at risk of postpartum complications . Taken all together, maternal mortality and morbidity is significantly elevated for obese women . Maternal obesity is also dangerous for the fetus and the newborn.The management of obesity requires a multidisciplinary approach. Stepwise programmes with realistic time-related goals are required, starting with modification of lifestyle, progressing to pharmacotherapy and ultimately obesity surgery. Weight loss interventions do not appear to be common practice among fertility centres& pre-pregnancy clinics in spite of clear evidence as to the benefits. Women should be referred to a nutritionist in cases where clinicians lack the knowledge and/or time to provide adequate counselling. ]]>

Obesity has many deleterious effects for women of reproductive age. In the first place, obese women are more likely to encounter problems becoming pregnant and they are more likely to miscarry They are at greater risk of developing pregnancy complications and problems associated with labour and delivery. Finally, obese women are more at risk of postpartum complications . Taken all together, maternal mortality and morbidity is significantly elevated for obese women . Maternal obesity is also dangerous for the fetus and the newborn.The management of obesity requires a multidisciplinary approach. Stepwise programmes with realistic time-related goals are required, starting with modification of lifestyle, progressing to pharmacotherapy and ultimately obesity surgery. Weight loss interventions do not appear to be common practice among fertility centres& pre-pregnancy clinics in spite of clear evidence as to the benefits. Women should be referred to a nutritionist in cases where clinicians lack the knowledge and/or time to provide adequate counselling. ]]>
Tue, 30 Oct 2018 16:25:49 GMT /slideshow/obesity-reproductive-health/121212276 wafaabenjamin@slideshare.net(wafaabenjamin) Obesity& reproductive health wafaabenjamin Obesity has many deleterious effects for women of reproductive age. In the first place, obese women are more likely to encounter problems becoming pregnant and they are more likely to miscarry They are at greater risk of developing pregnancy complications and problems associated with labour and delivery. Finally, obese women are more at risk of postpartum complications . Taken all together, maternal mortality and morbidity is significantly elevated for obese women . Maternal obesity is also dangerous for the fetus and the newborn.The management of obesity requires a multidisciplinary approach. Stepwise programmes with realistic time-related goals are required, starting with modification of lifestyle, progressing to pharmacotherapy and ultimately obesity surgery. Weight loss interventions do not appear to be common practice among fertility centres& pre-pregnancy clinics in spite of clear evidence as to the benefits. Women should be referred to a nutritionist in cases where clinicians lack the knowledge and/or time to provide adequate counselling. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/obesityreproductivehealth-181030162549-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Obesity has many deleterious effects for women of reproductive age. In the first place, obese women are more likely to encounter problems becoming pregnant and they are more likely to miscarry They are at greater risk of developing pregnancy complications and problems associated with labour and delivery. Finally, obese women are more at risk of postpartum complications . Taken all together, maternal mortality and morbidity is significantly elevated for obese women . Maternal obesity is also dangerous for the fetus and the newborn.The management of obesity requires a multidisciplinary approach. Stepwise programmes with realistic time-related goals are required, starting with modification of lifestyle, progressing to pharmacotherapy and ultimately obesity surgery. Weight loss interventions do not appear to be common practice among fertility centres&amp; pre-pregnancy clinics in spite of clear evidence as to the benefits. Women should be referred to a nutritionist in cases where clinicians lack the knowledge and/or time to provide adequate counselling.
Obesity& reproductive health from Wafaa Benjamin
]]>
1216 15 https://cdn.slidesharecdn.com/ss_thumbnails/obesityreproductivehealth-181030162549-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
Blood transfusion in obstetric haemorrhage /wafaabenjamin/blood-transfusion-in-obstetric-haemorrhage bloodtransfusioninobstetrics-181029222349
Blood transfusion may be a life-saving procedure but it is not without risk. Obstetric conditions associated with the need for blood transfusion (whether emergency or not) may lead to morbidity and mortality if not managed correctly. Adverse events associated with transfusion are increasingly important: So, strict adherence to correct sampling, cross-match and administration procedures is therefore of paramount importance, even in an emergency. ]]>

Blood transfusion may be a life-saving procedure but it is not without risk. Obstetric conditions associated with the need for blood transfusion (whether emergency or not) may lead to morbidity and mortality if not managed correctly. Adverse events associated with transfusion are increasingly important: So, strict adherence to correct sampling, cross-match and administration procedures is therefore of paramount importance, even in an emergency. ]]>
Mon, 29 Oct 2018 22:23:49 GMT /wafaabenjamin/blood-transfusion-in-obstetric-haemorrhage wafaabenjamin@slideshare.net(wafaabenjamin) Blood transfusion in obstetric haemorrhage wafaabenjamin Blood transfusion may be a life-saving procedure but it is not without risk. Obstetric conditions associated with the need for blood transfusion (whether emergency or not) may lead to morbidity and mortality if not managed correctly. Adverse events associated with transfusion are increasingly important: So, strict adherence to correct sampling, cross-match and administration procedures is therefore of paramount importance, even in an emergency. <img style="border:1px solid #C3E6D8;float:right;" alt="" src="https://cdn.slidesharecdn.com/ss_thumbnails/bloodtransfusioninobstetrics-181029222349-thumbnail.jpg?width=120&amp;height=120&amp;fit=bounds" /><br> Blood transfusion may be a life-saving procedure but it is not without risk. Obstetric conditions associated with the need for blood transfusion (whether emergency or not) may lead to morbidity and mortality if not managed correctly. Adverse events associated with transfusion are increasingly important: So, strict adherence to correct sampling, cross-match and administration procedures is therefore of paramount importance, even in an emergency.
Blood transfusion in obstetric haemorrhage from Wafaa Benjamin
]]>
1595 2 https://cdn.slidesharecdn.com/ss_thumbnails/bloodtransfusioninobstetrics-181029222349-thumbnail.jpg?width=120&height=120&fit=bounds presentation Black http://activitystrea.ms/schema/1.0/post http://activitystrea.ms/schema/1.0/posted 0
https://public.slidesharecdn.com/v2/images/profile-picture.png https://cdn.slidesharecdn.com/ss_thumbnails/sacrospinousligamentfixationforpelvicorganprolapse-latestevidence-241227072834-2dc7bd51-thumbnail.jpg?width=320&height=320&fit=bounds slideshow/sacrospinous-ligament-fixation-for-pelvic-organ-prolapse-latest-evidence-pptx/274424760 Sacrospinous Ligament ... https://cdn.slidesharecdn.com/ss_thumbnails/non-meshsurgeryforsuiwafaabasta-241227064309-da0b674e-thumbnail.jpg?width=320&height=320&fit=bounds slideshow/non-mesh-surgery-for-stress-urinary-incontinence/274423503 Non-Mesh surgery for S... https://cdn.slidesharecdn.com/ss_thumbnails/pre-termlabour-220523090349-cc403a54-thumbnail.jpg?width=320&height=320&fit=bounds wafaabenjamin/preterm-labourpptx Pre-term labour.pptx