Strategic Planning: Think to Done
0 likes52 views
The document outlines a strategic planning framework focusing on purpose-driven questions such as why an organization exists, its vision, mission, and actionable goals. It emphasizes the importance of the 'Golden Circle' by Simon Sinek, along with frameworks like SMART goals and SWOT analysis to guide decision-making and prioritization. The document serves as a guide for critically analyzing problems and developing a clear action plan for achieving objectives.
1 of 29
Download to read offline
Ad
Recommended
Lauren Isaacson - Productized Masterclasses
Lauren Isaacson - Productized Masterclasses Productized
油
The document discusses how to effectively turn research insights into informed decisions through methodologies such as qualitative and quantitative research, while emphasizing the importance of collaboration and clarity in research objectives. It outlines techniques for decision-making, including workshops and mixed methods, and addresses the limitations of each research type. The document stresses the significance of ethical decision-making and the need for transparency and alignment among stakeholders throughout the research process.Future ready learners workshop
Future ready learners workshopBridgetmck
油
The document discusses steps for preparing learning organizations and young people for an uncertain future of climate change and job disruption. It suggests focusing on the impacts of current changes, imagining possible futures, and developing new ideas for solutions. Young people expressed worries about climate change and automation but also hopes that technology could offer solutions. The document argues schools need to foster systems thinking, open-ended thinking, empathy, and ecology. It proposes organizing more around peer learning, play, plurality of ideas, and applying knowledge to real-world problems.Objective Setting, what to do
Objective Setting, what to doDavid Waller
油
The document outlines a structured approach to setting objectives for projects, emphasizing the importance of starting with a clear goal in mind and understanding the drivers that prompt action. It highlights the need for sound objectives that are SMART (Specific, Measurable, Achievable, Relevant, Time-bound) and the value of benefits management, focusing on the measurable results valued by stakeholders. The document concludes with the importance of prioritizing objectives and benefits before determining the methods to achieve them.Benefits of Benefits Management
Benefits of Benefits ManagementDavid Waller
油
The document discusses the importance of benefits management in delivering valuable outcomes to stakeholders, emphasizing the need to focus on 'what' benefits are rather than just 'how' projects are executed. It highlights the significance of understanding stakeholder perspectives and aligning project objectives with strategic needs. Key points include stakeholder analysis, differentiating between tactical and strategic benefits, and the necessity of starting with the end goals in mind.Training as a (T)eam
Training as a (T)eamScrum User Group South Africa
油
The document emphasizes the importance of team facilitation, coaching, and communication within agile and lean frameworks. Key points include the need to ask for help, self-awareness, and fostering an environment that allows individuals to flourish. It highlights strategic elements such as product vision, roadmap development, and effective problem-solving.Startup Bootcamp - Session 2 of 8 - Entrepreneur Traits
Startup Bootcamp - Session 2 of 8 - Entrepreneur TraitsAmit Seth
油
The document outlines a series of sessions aimed at cultivating entrepreneurial traits, including creativity, risk-taking, and perseverance, starting from January 10th to March 6th. Each session focuses on specific aspects, such as turning passion into business opportunities, financial management, and effective presentation skills. Additionally, participants are encouraged to research and present on an inspiring entrepreneur, emphasizing the qualities that contribute to success.SPARK 2016: The Rules of Subtraction: How Working With Less Can Help You Acco...
SPARK 2016: The Rules of Subtraction: How Working With Less Can Help You Acco...TrackMaven
油
The document discusses strategies for achieving success through effective subtraction, focusing on lowering expectations to enhance productivity. It emphasizes the importance of managing priorities instead of time and fostering a culture of autonomy within teams. Key takeaways include addressing blind spots, trusting the process, and valuing progress over perfection.MEFTI - Building a winning team
MEFTI - Building a winning teamElaine Chen
油
The document discusses strategies for forming effective entrepreneurial teams, emphasizing the importance of diversity in roles, skills, and backgrounds. It highlights six key ingredients for team effectiveness: clear roles and responsibilities, a defined working approach, effective decision-making, equitable participation, managing influence, and conflict resolution. Resources for further insight into team processes and effective meetings are also provided.A Start Up, a Small Bet and One Good OKR
A Start Up, a Small Bet and One Good OKRNeal D Taylor
油
The document outlines the journey of saltwood.io from concept to business within three months, emphasizing the importance of a clear objective, specifically an OKR. It highlights strategies such as agile practices, small bets for low-risk investments, and the significance of shared vision and commitment. Recommended readings relevant to these concepts are also provided.Harnessing the creative genius within your organization
Harnessing the creative genius within your organizationITEM
油
The document discusses harnessing creativity within organizations by emphasizing the importance of questioning assumptions, connecting different fields, and focusing on customer experience. It advocates for a structured approach through Lean Six Sigma, which includes defining problems clearly, aiming for continuous improvement, and simplifying processes. Additionally, it encourages fostering a culture of inquiry, rewarding attempts, and emphasizing incremental changes over large-scale transformations.Lets Make Great! an introduction to China's creativity consultancy
Lets Make Great! an introduction to China's creativity consultancyLet's Make Great!
油
The document introduces Let's Make Great, a creativity consultancy that provides training and coaching workshops to help teams and organizations develop creative thinking skills and lead through innovation, addressing the challenges of complex problems, changing facts, and unclear ways forward in an increasingly complex world. It discusses how creativity is the source of everything from personal fulfillment to corporate growth to industry leadership.5 quotes to live by
5 quotes to live byWilliam Miller
油
This document provides 5 quotes from successful business leaders about success, teamwork, ambition, and choices. The quotes are attributed to Steve Jobs, Bill Gates, Andy Frisella, Mark Zuckerberg, and J.K. Rowling. They emphasize that great things are accomplished through teams, past success can breed complacency, having ambitious dreams despite criticism, making progress through easier tasks, and that choices define a person more than abilities. The document concludes by promoting a process automation tool from Tallyfy and encouraging the reader to check out their website.Entrepreneurship and You (2013 Version)
Entrepreneurship and You (2013 Version)iain.verigin
油
This document discusses entrepreneurship and provides an overview of the Lean LaunchPad process for developing a startup business model. It emphasizes the importance of understanding customer needs through activities like creating a customer journey map and scorecard. The document recommends skills like creativity, strategy, communication, and basic finance that are important for entrepreneurial leaders. It also cautions that success will take time, using the example of how long it took for the iPod to become an instant success after its launch.Goal Summit 2016: Insights From Peter Drucker
Goal Summit 2016: Insights From Peter DruckerBetterWorks
油
The document provides insights from Peter Drucker's management theories, emphasizing decentralization, leadership of knowledge workers, and the importance of aligning organizational goals with individual strengths. Drucker advocates for innovation, social responsibility, and the necessity of planned abandonment of outdated practices to foster growth. It concludes with a call for a strong sense of purpose and the need for continuity in values amidst change.MEMSI June 2018: Building a company: Equity, Fundraising and more
MEMSI June 2018: Building a company: Equity, Fundraising and moreElaine Chen
油
The document discusses essential aspects of building a startup, including the dynamics of founding teams, the importance of defining roles and responsibilities, and the complexities of funding. It highlights factors that can strengthen or destroy teams, as well as practical considerations for fundraising strategies and investor relationships. Additionally, it provides resources for further reading on entrepreneurial challenges and fundraising methods.What people analytics cant capture
What people analytics cant capture Jayesh Dosi
油
This document discusses people analytics and management techniques. It provides definitions of people analytics as a technique to measure employee potential and skill often used by managers to reduce their stress. It also defines two types of managers - tyrant managers who overpressure employees and lead to long term unsuccessful outcomes, and friendly managers who understand employees and create a good working environment. It stresses the importance of asking questions to detect and overcome flaws, asking new questions regularly to improve data, and discovering new techniques to understand employee stress beyond algorithms and statistics.RedTree_Digital Hub_EOR
RedTree_Digital Hub_EOREamonn O'Reilly
油
This document provides advice for start-ups on how to compete for talent and identify the right candidates. It emphasizes focusing the job description on why someone would want to work for a start-up rather than an established company, keeping it flexible rather than rigid, and hiring for attitude over experience by assessing for traits like perseverance, determination and resilience. Common interview questions are also listed to help identify fit for the position and company culture.Fa102 b group project
Fa102 b group projectkaikikazuki
油
The document discusses customer journey mapping, which visualizes the process a customer goes through to achieve a goal. It can help shift a company's perspective to be more customer-centric. Creating customer journey maps involves deconstructing the customer experience into touchpoints and channels. Key elements to include are the customer's point of view, actions/mindsets/emotions at each stage, and insights. Rules for an effective map are to establish clear goals, base it on research, collaborate with stakeholders, focus on understanding before design, and engage others with an interactive presentation.Are you solving the right problem
Are you solving the right problemShaili Sinha
油
The document outlines a 4-step process for properly defining problems: 1) Establish the need for a solution by identifying the basic need, desired outcome, and beneficiaries. 2) Justify the needs by aligning with strategy, identifying benefits and how they'll be measured, and how a solution will be implemented. 3) Contextualize the problem by considering past approaches, constraints, and external factors. 4) Write a problem statement that clarifies if it's one problem or many, requirements for a solution, who should solve it, necessary information, and how solutions will be evaluated.Session 5: The Next Wave of Workplace Culture: Truly Developing Your People (...
Session 5: The Next Wave of Workplace Culture: Truly Developing Your People (...Udemy for Business
油
Patty McCord discusses evolving workplace culture by focusing on the development of employees as trustworthy adults and fostering high-performance teams. She emphasizes the importance of discipline, structure, and a spirit of innovation while questioning traditional best practices. Her approach includes a framework for change driven by clarity, honesty, curiosity, and continuous learning."The 5 Personas of Product Management (and How to Hire for Them)" by Jason Shen
"The 5 Personas of Product Management (and How to Hire for Them)" by Jason ShenProductized
油
The document outlines five distinct personas of product managers (PMs): Explorer, Advocate, Organizer, Technician, and the less defined fifth persona. Each persona has specific attributes and hiring considerations, such as Explorers focusing on market trends, Advocates being strong communicators, Organizers managing projects, and Technicians paying attention to product details. The document emphasizes the importance of understanding these personas when hiring PMs and includes situational questions tailored to assess candidates for each role.Unlock your ultimate success
Unlock your ultimate successskidemon
油
This document promotes the services of Peter Lepinski and his business innovation group for business and executive coaching, consulting, marketing, and human resources training. It outlines a formula for success that involves having a vision, setting goals, continuous learning, creating plans, and taking decisive action. Examples are given of how companies like Harley Davidson and Kodak achieved success by following this formula. Resources and environments that enable growth and understanding are suggested. The overall message is that keeping things simple can lead to success.Toronto Agile Tour - Timeless Leadership
Toronto Agile Tour - Timeless LeadershipJason Little
油
The document discusses the concept of timeless leadership, emphasizing the importance of learning from historical leadership models to foster great leadership today. It highlights that prioritizing employees leads to customer satisfaction and shareholder happiness, while encouraging leaders to empower others and co-create plans. Various leadership capabilities such as visioning, inventing, sense-making, and relating are outlined, alongside exercises designed to help individuals identify their own leadership styles and improvement areas.Session 1: Agile Learning in an Era of Disruption (Darren Shimkus, General Ma...
Session 1: Agile Learning in an Era of Disruption (Darren Shimkus, General Ma...Udemy for Business
油
Darren Shimkus discusses the challenges and opportunities in learning and development (L&D) amidst ongoing disruption, highlighting how automation and AI are transforming workplaces. He emphasizes the need for updated educational approaches, as traditional learning environments have remained largely unchanged for 150 years. The document features various industry leaders sharing insights on adapting to these changes to better support learners.What Makes A Great Leader: 10 Vital Traits Of A Great Leader
What Makes A Great Leader: 10 Vital Traits Of A Great LeaderMichael Lee
油
The document outlines ten essential traits that contribute to effective leadership, as identified by Michael Lee. These traits include determination, flexibility, resourcefulness, creativity, self-confidence, a positive attitude, responsibility, good communication skills, consistency, and forecasting abilities. Emphasizing that not all traits need to be possessed in full, the document encourages individuals to strive to develop these qualities to improve their leadership skills.Thoughts on Leadership
Thoughts on LeadershipDavid Winter
油
The document lists 28 ideas and lessons about leadership that the author has learned over time. Some of the key points include surrounding yourself with brilliant people, asking for ideas from others, accepting mistakes as long as you learn from them, keeping your promises and over delivering, encouraging diversity of perspectives to generate new ideas, and giving people responsibilities rather than just jobs. The author emphasizes that leadership is about putting the right people in the right roles and enabling their success through removing barriers.20 Ideas In 20 Minutes Rev3
20 Ideas In 20 Minutes Rev3David Winter
油
The document lists 28 ideas and lessons about leadership that the author has learned over time. Some of the key points include surrounding yourself with brilliant people, asking for ideas from others, accepting mistakes as long as you learn from them, having fun, and over-delivering on promises. The author advocates for putting the right people in the right jobs, knocking down barriers to their success, and encouraging diversity of perspectives to generate great ideas.Villanova leadership-102018
Villanova leadership-102018Sean Curtis
油
Sean Curtis graduated from Villanova University in 1998 and has since worked in leadership roles at several technology companies focusing on digital media and streaming. He discusses the importance of never stopping learning, inventing and simplifying processes, raising the bar, serving customers, delivering through ambiguity, earning trust, thinking like an owner, and finding work-life balance. Curtis shares lessons learned from leading teams and encourages the audience to find fulfilling careers and maintain professional networks.Strategic Planning 2007
Strategic Planning 2007Syed Yasar Abbas
油
The document outlines a workshop focused on the strategic planning process, detailing its importance, key characteristics, and the roles of senior management in executing it. It emphasizes the need for a strategic plan to define an organization's direction, prioritize actions, and assess performance through tools like SWOT and PEST analyses. Additionally, it covers the formulation and implementation of a strategic plan, including the establishment of missions, visions, and long-term goals.Constructing a Strategic Plan: Essential Processes and Components
Constructing a Strategic Plan: Essential Processes and Componentsksilk
油
This document outlines the key components and processes involved in strategic planning. It discusses the importance of investigating the organization's current situation, consulting stakeholders, considering strengths, weaknesses, opportunities and threats, and deciding on a mission, vision and strategies. It emphasizes that strategic planning requires courage, commitment, decisiveness, vision, leadership and measurement. The document provides details on each phase of the strategic planning process and stresses that measurement and evaluation are essential parts of assessing success and progress.More Related Content
What's hot (20)
A Start Up, a Small Bet and One Good OKR
A Start Up, a Small Bet and One Good OKRNeal D Taylor
油
The document outlines the journey of saltwood.io from concept to business within three months, emphasizing the importance of a clear objective, specifically an OKR. It highlights strategies such as agile practices, small bets for low-risk investments, and the significance of shared vision and commitment. Recommended readings relevant to these concepts are also provided.Harnessing the creative genius within your organization
Harnessing the creative genius within your organizationITEM
油
The document discusses harnessing creativity within organizations by emphasizing the importance of questioning assumptions, connecting different fields, and focusing on customer experience. It advocates for a structured approach through Lean Six Sigma, which includes defining problems clearly, aiming for continuous improvement, and simplifying processes. Additionally, it encourages fostering a culture of inquiry, rewarding attempts, and emphasizing incremental changes over large-scale transformations.Lets Make Great! an introduction to China's creativity consultancy
Lets Make Great! an introduction to China's creativity consultancyLet's Make Great!
油
The document introduces Let's Make Great, a creativity consultancy that provides training and coaching workshops to help teams and organizations develop creative thinking skills and lead through innovation, addressing the challenges of complex problems, changing facts, and unclear ways forward in an increasingly complex world. It discusses how creativity is the source of everything from personal fulfillment to corporate growth to industry leadership.5 quotes to live by
5 quotes to live byWilliam Miller
油
This document provides 5 quotes from successful business leaders about success, teamwork, ambition, and choices. The quotes are attributed to Steve Jobs, Bill Gates, Andy Frisella, Mark Zuckerberg, and J.K. Rowling. They emphasize that great things are accomplished through teams, past success can breed complacency, having ambitious dreams despite criticism, making progress through easier tasks, and that choices define a person more than abilities. The document concludes by promoting a process automation tool from Tallyfy and encouraging the reader to check out their website.Entrepreneurship and You (2013 Version)
Entrepreneurship and You (2013 Version)iain.verigin
油
This document discusses entrepreneurship and provides an overview of the Lean LaunchPad process for developing a startup business model. It emphasizes the importance of understanding customer needs through activities like creating a customer journey map and scorecard. The document recommends skills like creativity, strategy, communication, and basic finance that are important for entrepreneurial leaders. It also cautions that success will take time, using the example of how long it took for the iPod to become an instant success after its launch.Goal Summit 2016: Insights From Peter Drucker
Goal Summit 2016: Insights From Peter DruckerBetterWorks
油
The document provides insights from Peter Drucker's management theories, emphasizing decentralization, leadership of knowledge workers, and the importance of aligning organizational goals with individual strengths. Drucker advocates for innovation, social responsibility, and the necessity of planned abandonment of outdated practices to foster growth. It concludes with a call for a strong sense of purpose and the need for continuity in values amidst change.MEMSI June 2018: Building a company: Equity, Fundraising and more
MEMSI June 2018: Building a company: Equity, Fundraising and moreElaine Chen
油
The document discusses essential aspects of building a startup, including the dynamics of founding teams, the importance of defining roles and responsibilities, and the complexities of funding. It highlights factors that can strengthen or destroy teams, as well as practical considerations for fundraising strategies and investor relationships. Additionally, it provides resources for further reading on entrepreneurial challenges and fundraising methods.What people analytics cant capture
What people analytics cant capture Jayesh Dosi
油
This document discusses people analytics and management techniques. It provides definitions of people analytics as a technique to measure employee potential and skill often used by managers to reduce their stress. It also defines two types of managers - tyrant managers who overpressure employees and lead to long term unsuccessful outcomes, and friendly managers who understand employees and create a good working environment. It stresses the importance of asking questions to detect and overcome flaws, asking new questions regularly to improve data, and discovering new techniques to understand employee stress beyond algorithms and statistics.RedTree_Digital Hub_EOR
RedTree_Digital Hub_EOREamonn O'Reilly
油
This document provides advice for start-ups on how to compete for talent and identify the right candidates. It emphasizes focusing the job description on why someone would want to work for a start-up rather than an established company, keeping it flexible rather than rigid, and hiring for attitude over experience by assessing for traits like perseverance, determination and resilience. Common interview questions are also listed to help identify fit for the position and company culture.Fa102 b group project
Fa102 b group projectkaikikazuki
油
The document discusses customer journey mapping, which visualizes the process a customer goes through to achieve a goal. It can help shift a company's perspective to be more customer-centric. Creating customer journey maps involves deconstructing the customer experience into touchpoints and channels. Key elements to include are the customer's point of view, actions/mindsets/emotions at each stage, and insights. Rules for an effective map are to establish clear goals, base it on research, collaborate with stakeholders, focus on understanding before design, and engage others with an interactive presentation.Are you solving the right problem
Are you solving the right problemShaili Sinha
油
The document outlines a 4-step process for properly defining problems: 1) Establish the need for a solution by identifying the basic need, desired outcome, and beneficiaries. 2) Justify the needs by aligning with strategy, identifying benefits and how they'll be measured, and how a solution will be implemented. 3) Contextualize the problem by considering past approaches, constraints, and external factors. 4) Write a problem statement that clarifies if it's one problem or many, requirements for a solution, who should solve it, necessary information, and how solutions will be evaluated.Session 5: The Next Wave of Workplace Culture: Truly Developing Your People (...
Session 5: The Next Wave of Workplace Culture: Truly Developing Your People (...Udemy for Business
油
Patty McCord discusses evolving workplace culture by focusing on the development of employees as trustworthy adults and fostering high-performance teams. She emphasizes the importance of discipline, structure, and a spirit of innovation while questioning traditional best practices. Her approach includes a framework for change driven by clarity, honesty, curiosity, and continuous learning."The 5 Personas of Product Management (and How to Hire for Them)" by Jason Shen
"The 5 Personas of Product Management (and How to Hire for Them)" by Jason ShenProductized
油
The document outlines five distinct personas of product managers (PMs): Explorer, Advocate, Organizer, Technician, and the less defined fifth persona. Each persona has specific attributes and hiring considerations, such as Explorers focusing on market trends, Advocates being strong communicators, Organizers managing projects, and Technicians paying attention to product details. The document emphasizes the importance of understanding these personas when hiring PMs and includes situational questions tailored to assess candidates for each role.Unlock your ultimate success
Unlock your ultimate successskidemon
油
This document promotes the services of Peter Lepinski and his business innovation group for business and executive coaching, consulting, marketing, and human resources training. It outlines a formula for success that involves having a vision, setting goals, continuous learning, creating plans, and taking decisive action. Examples are given of how companies like Harley Davidson and Kodak achieved success by following this formula. Resources and environments that enable growth and understanding are suggested. The overall message is that keeping things simple can lead to success.Toronto Agile Tour - Timeless Leadership
Toronto Agile Tour - Timeless LeadershipJason Little
油
The document discusses the concept of timeless leadership, emphasizing the importance of learning from historical leadership models to foster great leadership today. It highlights that prioritizing employees leads to customer satisfaction and shareholder happiness, while encouraging leaders to empower others and co-create plans. Various leadership capabilities such as visioning, inventing, sense-making, and relating are outlined, alongside exercises designed to help individuals identify their own leadership styles and improvement areas.Session 1: Agile Learning in an Era of Disruption (Darren Shimkus, General Ma...
Session 1: Agile Learning in an Era of Disruption (Darren Shimkus, General Ma...Udemy for Business
油
Darren Shimkus discusses the challenges and opportunities in learning and development (L&D) amidst ongoing disruption, highlighting how automation and AI are transforming workplaces. He emphasizes the need for updated educational approaches, as traditional learning environments have remained largely unchanged for 150 years. The document features various industry leaders sharing insights on adapting to these changes to better support learners.What Makes A Great Leader: 10 Vital Traits Of A Great Leader
What Makes A Great Leader: 10 Vital Traits Of A Great LeaderMichael Lee
油
The document outlines ten essential traits that contribute to effective leadership, as identified by Michael Lee. These traits include determination, flexibility, resourcefulness, creativity, self-confidence, a positive attitude, responsibility, good communication skills, consistency, and forecasting abilities. Emphasizing that not all traits need to be possessed in full, the document encourages individuals to strive to develop these qualities to improve their leadership skills.Thoughts on Leadership
Thoughts on LeadershipDavid Winter
油
The document lists 28 ideas and lessons about leadership that the author has learned over time. Some of the key points include surrounding yourself with brilliant people, asking for ideas from others, accepting mistakes as long as you learn from them, keeping your promises and over delivering, encouraging diversity of perspectives to generate new ideas, and giving people responsibilities rather than just jobs. The author emphasizes that leadership is about putting the right people in the right roles and enabling their success through removing barriers.20 Ideas In 20 Minutes Rev3
20 Ideas In 20 Minutes Rev3David Winter
油
The document lists 28 ideas and lessons about leadership that the author has learned over time. Some of the key points include surrounding yourself with brilliant people, asking for ideas from others, accepting mistakes as long as you learn from them, having fun, and over-delivering on promises. The author advocates for putting the right people in the right jobs, knocking down barriers to their success, and encouraging diversity of perspectives to generate great ideas.Villanova leadership-102018
Villanova leadership-102018Sean Curtis
油
Sean Curtis graduated from Villanova University in 1998 and has since worked in leadership roles at several technology companies focusing on digital media and streaming. He discusses the importance of never stopping learning, inventing and simplifying processes, raising the bar, serving customers, delivering through ambiguity, earning trust, thinking like an owner, and finding work-life balance. Curtis shares lessons learned from leading teams and encourages the audience to find fulfilling careers and maintain professional networks.Similar to Strategic Planning: Think to Done (20)
Strategic Planning 2007
Strategic Planning 2007Syed Yasar Abbas
油
The document outlines a workshop focused on the strategic planning process, detailing its importance, key characteristics, and the roles of senior management in executing it. It emphasizes the need for a strategic plan to define an organization's direction, prioritize actions, and assess performance through tools like SWOT and PEST analyses. Additionally, it covers the formulation and implementation of a strategic plan, including the establishment of missions, visions, and long-term goals.Constructing a Strategic Plan: Essential Processes and Components
Constructing a Strategic Plan: Essential Processes and Componentsksilk
油
This document outlines the key components and processes involved in strategic planning. It discusses the importance of investigating the organization's current situation, consulting stakeholders, considering strengths, weaknesses, opportunities and threats, and deciding on a mission, vision and strategies. It emphasizes that strategic planning requires courage, commitment, decisiveness, vision, leadership and measurement. The document provides details on each phase of the strategic planning process and stresses that measurement and evaluation are essential parts of assessing success and progress.Strategic Management: The Ultimate Goal of Strategic Planning
Strategic Management: The Ultimate Goal of Strategic Planning Kathy Brandt
油
The document outlines the importance of strategic planning, emphasizing engagement of staff and experts, establishing a decision-making framework, and setting realistic goals for organizational growth. It identifies common reasons plans fail and offers essential practices for effective planning, such as assigning responsibilities, monitoring progress, and maintaining communication. Additionally, strategic questions are posed to guide leadership in assessing failures, successes, and future directions.Strategic planning & implementing - performing strategy+ best results=bigger ...
Strategic planning & implementing - performing strategy+ best results=bigger ...Jacopo Nicelli
油
The document discusses strategic planning and implementation. It provides elements of strategic planning including defining the present situation, desired future, goals, and strategy. It emphasizes that strategic planning should be future focused, leadership driven, allow for organizational involvement, and create measurable objectives. It also discusses the importance of effective implementation, overcoming barriers, and mitigating risks to ensure the strategy is executed as intended.STRATEGIC CONVERSATION
STRATEGIC CONVERSATIONEduard Scholtz
油
This document discusses strategic conversations and strategy development. It contains quotes and perspectives on leadership, collaboration, technology, strategy, and strategic conversations. The document advocates for strategic conversations to reduce uncertainty and leverage human talent. It provides models and questions to guide strategic conversations, emphasizing the need to identify opportunities and focus resources for maximum impact and returns.Strategic planning in agribusiness lecture1
Strategic planning in agribusiness lecture1CSIR-CRI (crop research instituete)
油
The document provides an overview of strategic planning and management. It defines strategic management as a continuous process led by senior leaders to set the strategic direction of an organization and link strategic planning to day-to-day operations. The strategic management process involves five steps - pre-planning, strategic planning, deployment, implementation, and measurement and evaluation. The first step is to develop a strategic plan, which includes conducting an internal and external assessment using a SWOT analysis to identify strengths, weaknesses, opportunities, and threats.Strategic planning
Strategic planningBill Taylor
油
This document provides an overview of strategic planning for boards. It defines strategic planning as a deliberative process to make fundamental decisions that guide an organization. The key components of strategic planning include developing a mission, values, vision, and SWOC analysis. Goals and objectives are created at the strategic, tactical, and operational levels. An implementation plan and monitoring system are also important parts of the strategic planning process. The overall process helps organizations address challenges and enhances learning to effectively achieve their missions.Strategic Planning Series Part II 2014
Strategic Planning Series Part II 2014Roy Barker
油
Roy Barker from Moore Diversified Services presented on strategic planning. He discussed conducting a SWOT analysis and reviewing key performance indicators to assess the current situation. The presentation focused on aligning goals with the organization's mission and vision, setting SMART goals, developing an operational plan, monitoring progress, and refining the plan. Barker emphasized communicating the strategic plan throughout the organization and evaluating results to ensure the goals are achieved.Strategic Management chap01
Strategic Management chap01Masroor Soomro
油
The document provides a comprehensive overview of strategic management, outlining its key components such as vision and mission statements, long-term objectives, strategy formulation, implementation, and performance evaluation. It highlights the evolution of strategic management from strategic planning origins in the 1950s to its contemporary application in various organizational contexts, emphasizing the importance of internal and external audits, SWOT analysis, and strategic decision-making. Additionally, it details various corporate strategies, competitive strategies, and the significance of aligning organizational structure with strategic goals.Strategies, policies and planning premises
Strategies, policies and planning premisesBabak Mohajeri
油
This document discusses strategies, policies, and strategic planning. It covers the following key points in 3 sentences:
Strategies exist at the corporate, business unit, and functional levels and include a company's competitive moves, internal approaches, and action plans. Strategic planning involves analyzing the internal strengths and weaknesses as well as external opportunities and threats, setting objectives, and crafting strategies to guide the organization. Effective implementation of strategies requires consideration of factors like technology, human resources, decision processes, and organizational culture.Strategic thinking Handout
Strategic thinking HandoutPower2Improve
油
This document provides an overview of strategic thinking and analysis techniques. It discusses performing internal and external analyses to understand an organization's current position. Key frameworks covered include SMART goals, playing field analysis considering factors like time and money, and analyzing external DESTEPL factors related to demographics, economics, technology, etc. The document also discusses strategic planning, stakeholder analysis, and using tools like SWOT analysis to identify improvements. The overall summary is that the document outlines various frameworks and techniques for conducting a strategic analysis of an organization to understand its current position and identify opportunities.SSAWG 2018 strategic planning mini course
SSAWG 2018 strategic planning mini courseTamara Jones
油
This document outlines an agenda and presentation for a workshop on improving strategic and program planning. The full-day workshop covers the seven steps of strategic planning, including preparing to plan, information gathering, analyzing critical issues, developing a strategic plan document, resource planning, implementation, and monitoring and evaluation. Key aspects of strategic planning are defined, such as goals, objectives, strategies and critical success factors. The workshop aims to help participants understand how to create a strategic plan that translates their vision into measurable results and improves their organization's impact.otkpufrhkphogfhg.pptqseawdfsfsdffdfsertrtyfgy
otkpufrhkphogfhg.pptqseawdfsfsdffdfsertrtyfgykarthicks381361
油
The document outlines strategies for vision and mission formulation, corporate governance, and strategic management. It emphasizes the importance of clear definitions for goals, objectives, and measurement metrics, as well as the roles of leadership in guiding organizations. Additionally, it discusses various environmental factors affecting strategic planning and highlights frameworks for effective implementation and assessment of organizational performance.Planning in Management (Principles of management)
Planning in Management (Principles of management)Abdulmughni Ansari
油
The document discusses the principles of management, specifically focusing on planning, decision-making, objectives, and strategies within organizations. It highlights the crucial role of planning in providing direction, risk reduction, and promoting innovation, while also outlining its limitations. Additionally, it covers various types of decisions, the decision-making process, the significance of establishing objectives, and the importance of formulating strategies for organizational success.stratmgmt.ppt
stratmgmt.pptMbabba2
油
This document provides an overview of key concepts in strategic management including the canoe theory, built to last principles, good to great findings, differences between public and private organizations, features of successful strategic management, lessons learned in strategic planning, why managers don't plan, the strategic management model, and components of strategy formulation like vision, mission, values, goals and objectives. It also discusses scanning the external and internal environment, industry analysis, competitive profiling, and implementing and measuring strategies.CHAPTER 1 STRATEGIC MANAGEMENT.pptx
CHAPTER 1 STRATEGIC MANAGEMENT.pptxanin51
油
This document provides an overview of strategic management. It discusses key concepts like vision, mission, goals, the strategic management process, and characteristics of strategic decisions at different levels. The strategic management process involves selecting a mission/goals, analyzing external/internal environments, formulating strategies, and implementing strategies. Goals should be SMART (specific, measurable, attainable, realistic, and time-bound). External/internal analyses identify opportunities/threats and strengths/weaknesses. Strategies are made at corporate, business, and functional levels with varying risk, cost, and time horizons.Neshs Webinar 12 17 2009 Presentation Handout
Neshs Webinar 12 17 2009 Presentation HandoutAmy MacNulty
油
The document summarizes a webinar on best practices for linking strategic planning and business intelligence to improve performance. It discusses organizing a strategic planning process, raising the bar on healthcare strategic planning, translating plans into action, and using business intelligence to monitor plan implementation and make decisions. Business intelligence tools like dashboards and ad hoc reports can help track key performance indicators, visualize strategy alignment, and drill down into details.stratmgmt.ppt
stratmgmt.pptMbabba2
油
The document provides an overview of strategic management concepts including the canoe theory, built to last principles, good to great frameworks, differences between private and public organizations, scanning the external environment, industry analysis using Porter's five forces, developing vision, mission, values and goals, and implementing and measuring strategies. It discusses models for strategic management and formulation, highlights reasons why measurement is important, and provides tips for keeping plans from sitting on shelves and developing organizational permanence around strategic management. The key takeaways are frameworks and considerations for analyzing the environment, formulating strategies, implementing plans, and measuring performance in organizations.Strategic Actions Investment Awareness Improvement Resources Planning Organis...
Strategic Actions Investment Awareness Improvement Resources Planning Organis...際際滷Team
油
The document outlines steps for developing a strategic action plan, including discussing the plan with a group, clarifying resources and strategies, identifying what will change first, convincing individuals affected by the problem, developing a mission statement, and determining how, what, and when to accomplish the objectives. It also provides examples of strategic action planning processes, such as defining goals and accountability, analyzing organizational position, and prioritizing criteria. The document provides templates for strategic action planning, including tables to identify action items, responsible parties, timelines, progress, and expenses.Collaborative strategicplanning
Collaborative strategicplanningWandi Husein
油
This document discusses tools for engaging employees in strategic planning. It describes a three-phase strategic planning process that includes structuring the process, gathering information, synthesizing goals and plans, and implementing the plan. The process involves establishing a strategic planning team, surveying stakeholders, reviewing the mission and vision, conducting a SWOT analysis to identify strengths, weaknesses, opportunities and threats, and developing strategic goals and targets to guide implementation.Ad
Recently uploaded (6)
Understanding Pay Per Call_ A Guide for Affiliates and Advertisers!.pdf
Understanding Pay Per Call_ A Guide for Affiliates and Advertisers!.pdfMutualCall
油
MutualCall is a Premium Pay Per Call Affiliate Network, offering high-quality inbound & outbound calls and exceptional lead generation services. As experts in Pay Per Call and affiliate marketing, we drive business growth by delivering top-tier leads across multiple sectors. Our advanced call tracking system ensures that every campaign is optimized for maximum performance, giving you the competitive edge needed to succeed.Building Financial Resilience_ Why Its More Important Than Ever
Building Financial Resilience_ Why Its More Important Than EverMatt Dixon
油
"Building Financial Resilience: Why Its More Important Than Ever"** explores the critical need for individuals and families to strengthen their financial stability in an increasingly uncertain world. This piece highlights practical strategies for managing debt, saving effectively, and preparing for unexpected challengesempowering readers to take control of their financial future with confidence.Why Outsourcing Web Development Matters for Non-Technical Founders 1.pdf
Why Outsourcing Web Development Matters for Non-Technical Founders 1.pdfInnvatonMServices
油
Launching a web development project without deep technical expertise can be intimidating for many startup founders, CTOs, and IT consultants.Local SEO Guide 2025-12 Strategies Explained.pdf
Local SEO Guide 2025-12 Strategies Explained.pdfKHM Anwar
油
Local SEO Guide: Why do some shops appear on Google Maps while others do not? This article will help you get your coffee shop at the top of local searches. Search engines reveal their new methods every few months. For instance, today, 55% of users search for information about people and places in their vicinity.
Simply having an online presence is no longer enough. You have to specialize in your area. If you deliver pizza or fix roofs next door, make your presence felt locally.
These Local SEO Guide-twelve tips will help create your local authority on search results pages in 2025. They are responsive to modern-day algorithms and build on what others say about you. You may now get noticed by those who live close by. Let us get started.The Ultimate Guide to Local SEO Automation.pdf
The Ultimate Guide to Local SEO Automation.pdfKHM Anwar
油
Are you exhausted by your rivals success in local search results? Local SEO Automation is changing digital marketings rules. Discover ten smart tools to dominate local SEO by 2025. These tools will simplify your processes and make it easy for customers to find you.
The game-changing applications worthy of being in your toolkit include Local SEO automation tools that simplify tasks such as optimizing Google Business Profiles, gathering customer reviews, and establishing consistent citations across the Internet.Expert Industrial Machine Repair CNC Servicing Preventative Maintenance.pptx
Expert Industrial Machine Repair CNC Servicing Preventative Maintenance.pptxMachine Ethics
油
Machine Ethics LLC is a Michigan-based industrial machine service company specializing in CNC repair, preventative maintenance, and equipment installations. With nearly 20 years of experience, we help manufacturers reduce downtime and extend equipment lifeoffering expert repairs, custom PM programs, and affordable alternatives to OEM service. From mechanical and electrical issues to full machine rebuilds, our skilled technicians deliver reliable, cost-effective solutions across Michigan and the Great Lakes region.
Ad
Strategic Planning: Think to Done
- 1. klmc | 2020-09-24 strategic planning: thinkto done
- 3. why do we exist? where do we want to be? how do we get there on purpose? what steps do we need to take?
- 4. answer these simple questions deeply
- 5. the golden circle why how what From: Simon Sinek Start with Why
- 6. Simon Sinek Start with Why: How Great Leaders Inspire Everyone to Take Action People dont buy what you do; they buy why you do it...what you do simply proves what you believe.
- 7. the golden circle why how what From: Simon Sinek Start with Why vision mission goals
- 9. why does your company exist? vision why?
- 10. where do we want to be in the future? vision why?
- 11. Tesla: To accelerate the world's transition to sustainable energy. vision why?
- 12. mission how? how
- 13. how do we make our vision happen? mission how?
- 14. Tesla: To create the most compelling car company of the 21st century by driving the worlds transition to electric vehicles. mission how?
- 15. personal interest + people interest mission how?
- 16. Onliness Statement Find what makes you different. Our offering is the only category that benefit for customer . offering category bene鍖t ideal customer From: Marty Neumeier Zag mission how?
- 17. goals what? what
- 18. D.E.C.I.D.E. Framework How to think through a problem critically. Determine the problem Establish the criteria Consider all alternatives Identify best alternative Develop an action plan Evaluate the solution goals what? From: Kristina L Guo DECIDE: A decision-making model for more effective decision making by health care managers
- 19. Identify best alternative Develop an action plan Evaluate the solution do the work. How to actually get things done. 1. Know where you want to go. (Vision / Mission / Onliness) 2. Create measurable (SMART) goals. 3. List the tasks that you need to do to accomplish those goals. (What) 4. Prioritize the tasks. 5. Decide who will do each task. (Who) 6. Agree upon deadlines for tasks. (When) 7. Track and measure the results.
- 20. S.M.A.R.T. Goals Set measurable objectives. From: George T. Doran Management Review Speci鍖c Measurable Assignable Realistic Time-related goals what?
- 22. write down all tasks
- 24. Eisenhower Matrix Prioritize your tasks. Do Decide Delete Delegate Important NotImportant Urgent Not Urgent
- 25. SWOT Analysis
- 26. SWOT Analysis This tools helps analyze a situation or solution from all sides. Strengths Weaknesses Threats Opportunities InternalExternal Helpful Harmful
- 27. act faster
- 28. Decide Fast Consider Carefully when you can change it later when you know the problem domain intimately when the stakes are low when not acting is likely worse when slow response increases pressure and decreases good will when your response unblocks others ex. choosing the best color for a product when the decision is permanent (or too expensive to reverse) when the problems are complex and the second order effects unknown when the stakes or pressure are high (existential threats) ex. choosing a platform to build on should I decide fast or slow?
- 29. thank you