Untitled Presentation
0 likes53 views
This short document promotes creating presentations using Haiku Deck, a tool for making slideshows. It encourages the reader to get started making their own Haiku Deck presentation and sharing it on 際際滷Share. In just one sentence, it pitches the idea of using Haiku Deck to easily create engaging slideshows.
1 of 5
Download to read offline
Recommended
Satisfied?
Satisfied?Mark Pomery
油
The document contains summaries of Bible passages about Elijah confronting King Ahab and the prophets of Baal on Mount Carmel. It also contains passages encouraging Christians not to be obsessed with wealth and material goods that are temporary, but to instead focus on eternal spiritual riches by helping others. The document promotes prioritizing God and finding satisfaction in Him above all things.MCR
MCRJ. Edward Semple
油
The document summarizes the Passerini reaction and its use in synthesizing 留-hydroxy-硫-amino acid derivatives and related compounds. It describes how treating 留-amino aldehydes with trifluoroacetic acid (TFA) and a pyridine-type base generates 留-hydroxy-硫-amino amide products in good yields with retention of stereochemistry. A variety of amino acid derivatives have been synthesized using this method. The products have applications as protease inhibitors, natural products, and imaging agents.JMC 1996 39 4531LactamSulf
JMC 1996 39 4531LactamSulfJ. Edward Semple
油
This document describes the design, synthesis, and evaluation of novel thrombin inhibitors incorporating P3-P4 lactam sulfonamide moieties. The inhibitors were designed to exploit interactions with thrombin's S2 and S3 sites to improve selectivity over related serine proteases. A series of 5-7 membered lactam rings were synthesized and incorporated a P1 argininal group. X-ray crystallography of one inhibitor bound to thrombin confirmed the predicted binding mode. In vitro testing showed several inhibitors had low nanomolar IC50 values against thrombin and good selectivity over trypsin and factor Xa. Overall, the lactam sulfonamides represent a new class of orally bioavailable
YoutubeNelly Huaman Valqui
油
El documento proporciona instrucciones para crear una cuenta de YouTube y subir un video a la plataforma. Explica los pasos para generar una cuenta de Gmail y completar la informaci坦n requerida por YouTube. Luego, detalla el proceso para seleccionar un video desde la computadora y cargarlo a YouTube, incluyendo agregar metadatos como t鱈tulo, descripci坦n y etiquetas. Finalmente, indica c坦mo copiar el c坦digo de incorporaci坦n para publicar el video en un blog o p叩gina web.It Takes a Village: Effective Collaboration in Security
It Takes a Village: Effective Collaboration in SecurityPhilip Beyer
油
This document discusses effective collaboration in security. It emphasizes understanding colleagues' behaviors and communication styles using tools like DiSC. It also discusses how to influence choices through nudges by structuring options, using defaults, feedback and simplifying complex decisions. The goal is to improve collaboration by triggering intuitive thinking and engaging more reflective thinking. Resources on behavioral economics, decision architecture and cognitive biases are also provided.
The Self-Curated Online and Offline Identities: One and at Odds
The Self-Curated Online and Offline Identities: One and at Oddsaroselacey
油
A consideration of the implications of the digital world, particularly social media, on the construction of self identity.Features of the Resident Fund Management Service
Features of the Resident Fund Management ServiceMark Sanfacon
油
Mark Sanfacon is the CEO of National Datacare Corporation, which provides patient financial account management services to over 6,000 nursing homes. National Datacare created the Resident Fund Management Service (RFMS) to offer a full-service solution for long-term care facilities. RFMS allows for direct debit payments from resident accounts to simplify billing. It also maintains regulatory compliance through daily transaction reports. The system separates resident and facility funds by automatically transferring medical fee payments from resident accounts to the nursing home operating account upon income deposit, while keeping personal allowance funds in individual resident accounts.Real life, Online relationships
Real life, Online relationshipsCarly Zatzman
油
This document appears to be a presentation about relationships in real life versus online relationships. It consists of 22 slides with various stock photos and images relating to social media, phones, online communication, and relationships. The presentation was created with Haiku Deck presentation software.Relationships & Social Media
Relationships & Social MediaSharah Isner
油
74% of online adults use social media to maintain relationships both near and far. While social media allows ambient intimacy, it does not replace real human interaction. It is important to be aware of potential issues with oversharing personal relationships online or feeling jealous of others' posts. Caution is advised but relationships should not be hindered by social media anxieties.Robert Johnson Resume (1)
Robert Johnson Resume (1)Robert Johnson
油
Robert Johnson is providing his resume which includes his personal and contact information, work history in law enforcement and security services, education including a bachelor's degree in criminal justice, and certificates and training. He has over 15 years of experience in law enforcement and security services in Arkansas and Florida.LET & RBE and Radioprotectors
LET & RBE and RadioprotectorsDrAyush Garg
油
Linear Energy Transfer (LET) refers to the amount of energy deposited by ionizing radiation per unit distance traveled. High LET radiation like alpha particles and neutrons deposit large amounts of energy over short distances, while low LET radiation like x-rays deposit energy sparsely over longer tracks. High LET radiation is more biologically destructive due to dense localized DNA damage. Relative Biological Effectiveness (RBE) compares the biological effects of different radiations, with higher RBE indicating greater effectiveness. RBE increases with LET up to around 100 keV/亮m due to optimal DNA double-strand break formation, then decreases at higher LET. Sulfhydryl compounds like cysteamine are effective radioprotectors by scavenging free radicalsSurgical management of carcinoma cervix
Surgical management of carcinoma cervixDrAyush Garg
油
This document summarizes the surgical management and classification of stages of carcinoma of the cervix. It outlines the different types of surgical procedures used to treat various stages of cervical cancer, from conization for stage IA1 to radical hysterectomy for stage IB and chemoradiation for stages II-IV. It describes 5 types of surgical procedures ranging from simple hysterectomy to exenteration based on the extent of resection. Radical trachelectomy is mentioned as a fertility-preserving option for early stage disease in younger patients.Onwednesdayswewearpinkfinal
Onwednesdayswewearpinkfinaltiffanymelo
油
On Wednesday's We Wear Pink - Presentation given by Tiffany Melo and Gia Ilole at the NACE Conference in 2015.How The Internet Has Changed The Dating Game
How The Internet Has Changed The Dating GameMonique Deziel
油
This flip book presents how the use of technology and social media has changed the way we date and form relationships.
More Related Content
Viewers also liked (8)
Real life, Online relationships
Real life, Online relationshipsCarly Zatzman
油
This document appears to be a presentation about relationships in real life versus online relationships. It consists of 22 slides with various stock photos and images relating to social media, phones, online communication, and relationships. The presentation was created with Haiku Deck presentation software.Relationships & Social Media
Relationships & Social MediaSharah Isner
油
74% of online adults use social media to maintain relationships both near and far. While social media allows ambient intimacy, it does not replace real human interaction. It is important to be aware of potential issues with oversharing personal relationships online or feeling jealous of others' posts. Caution is advised but relationships should not be hindered by social media anxieties.Robert Johnson Resume (1)
Robert Johnson Resume (1)Robert Johnson
油
Robert Johnson is providing his resume which includes his personal and contact information, work history in law enforcement and security services, education including a bachelor's degree in criminal justice, and certificates and training. He has over 15 years of experience in law enforcement and security services in Arkansas and Florida.LET & RBE and Radioprotectors
LET & RBE and RadioprotectorsDrAyush Garg
油
Linear Energy Transfer (LET) refers to the amount of energy deposited by ionizing radiation per unit distance traveled. High LET radiation like alpha particles and neutrons deposit large amounts of energy over short distances, while low LET radiation like x-rays deposit energy sparsely over longer tracks. High LET radiation is more biologically destructive due to dense localized DNA damage. Relative Biological Effectiveness (RBE) compares the biological effects of different radiations, with higher RBE indicating greater effectiveness. RBE increases with LET up to around 100 keV/亮m due to optimal DNA double-strand break formation, then decreases at higher LET. Sulfhydryl compounds like cysteamine are effective radioprotectors by scavenging free radicalsSurgical management of carcinoma cervix
Surgical management of carcinoma cervixDrAyush Garg
油
This document summarizes the surgical management and classification of stages of carcinoma of the cervix. It outlines the different types of surgical procedures used to treat various stages of cervical cancer, from conization for stage IA1 to radical hysterectomy for stage IB and chemoradiation for stages II-IV. It describes 5 types of surgical procedures ranging from simple hysterectomy to exenteration based on the extent of resection. Radical trachelectomy is mentioned as a fertility-preserving option for early stage disease in younger patients.Onwednesdayswewearpinkfinal
Onwednesdayswewearpinkfinaltiffanymelo
油
On Wednesday's We Wear Pink - Presentation given by Tiffany Melo and Gia Ilole at the NACE Conference in 2015.How The Internet Has Changed The Dating Game
How The Internet Has Changed The Dating GameMonique Deziel
油
This flip book presents how the use of technology and social media has changed the way we date and form relationships.Untitled Presentation
- 6. Inspired? Create your own Haiku Deck presentation on 際際滷Share! GET STARTED