www.wjtfintech.com
Senior, hands-on, financial technologist. Extensive experience helping financial businesses from start-ups to global banks achieve their technology mandates. Excellent inter-personal and client relationship management skills.
Domain expertise in trading systems, news and social media analytics, low latency market data (big data) and cloud computing.
Strong Python, Javascript, data manipulation, and hacking skills enable me to dig deep in to the technology stack to suggest and provide solutions to challenging issues.
Recent experience managing upgrade of legacy banking systems to front, middle and back office in multi-national bank across equities, fixed income, ...
Contact Details
Tags
financewjtglobaltechnologyhedge fundhigh frequency tradingtradingrisksolutionsquantfixed incomewjtglobalcomfxmarketcepomsemsdatamanagementclearingvisionmaproadmanagerassetfundhedgecapitalperformancepaperoffshoretipswhitedevelopmentsoftwarebusinesssmallnewsletterconsultingmultistrategybrokerprimesettlementgridhftemsnetworkstart-upomslow latencystat arbevolvecommitiesquantitativetraderwjtcapitalcomfhtfuturesfuturewillard john thomasworkshopcloudanalysishedgeworldnewsdmaalgorithmicengineeringifitechigh performancehighperformancefrequencyhighcitadelolovyannikovtradingfinancetradingglobalobamatechmapwjt global solutions
We鈥檝e updated our privacy policy so that we are compliant with changing global privacy regulations and to provide you with insight into the limited ways in which we use your data.
You can read the details below. By accepting, you agree to the updated privacy policy.
