1. The document is the June 2009 newsletter of the North East Safety Groups. It provides updates on various health and safety seminars, accidents that occurred, and fines issued to companies for safety violations.
2. Several stories describe accidents that resulted in serious injuries or death to workers from falls, chemical exposure, and being struck by machinery. The companies involved were fined between £2,000 to £80,000.
3. The newsletter also provides information on upcoming safety training courses and announces the results of the group's annual general meeting.
Tech challenges in a large scale agile projectHarald Soevik1. The document discusses three major technical challenges faced in a large-scale Java project that adopted Scrum methodology: modularization, testing environments, and declaratively representing domain knowledge.
2. For modularization, the project struggled with creating an optimal structure that balanced complexity, coupling, and cohesion across modules. Testing multiple environments provided benefits but also challenges in maintenance and automation.
3. Representing domain knowledge declaratively aimed to separate knowledge from implementation, but specific issues are not discussed in the summary due to a missing portion of the original text.
PublisoftmrdibyenduIBS Consultancy Services Pvt. Ltd. offers a client server architecture software solution for businesses with modules for billing, marketing, production, and MIS. The software provides a multi-user environment on a multi-client platform with tightly integrated modules, data backup capabilities, and a simple graphical user interface at low operational and hardware costs.
Unit 1 First Americans Student Ajessica tylerThe document provides information about the eight main cultural regions of Native Americans: Northwest Coast, California, Great Basin, Plateau, Great Plains, Southwest, Eastern Woodlands, and Southeast. Each region is described in terms of its climate, natural resources, housing, clothing, tools, and way of life. The regions varied significantly based on their unique environments but also shared some common cultural aspects like spirituality connected to nature and communal living.
CashcommmrdibyenduCashComm is a software solution developed by IBS Consultancy Services Pvt. Ltd. to manage operations for cable operators. It allows for user administration, customer registration, zone creation, employee management, billing, payment processing, reporting, backup and restore functionality. The software provides features to divide customers into zones, assign zones to collection agents, calculate commissions, create and maintain pay channels and special offers, and generate monthly bills.
Digital Design TrendsLouise McGregorThe document discusses trends in digital design, including mobile first design which focuses on optimizing content and navigation for small screens like phones. It also discusses responsive design which adapts content for different screen sizes, and how content is increasingly being designed to be easily shared on social media. Large images are also being used more prominently on websites, along with icons to convey meaning quickly. Infographics and infinite scrolling single page sites are growing in popularity as well.
Social lions190213GIROIDEA Avanguardia ComunicativaNell'era del Social Network vogliamo condividere quali potrebbero essere le opportunità per le PMI che si affacciano a questo cambio epocale.
Common Thread TechnologiesASHRAE PHILIPPINESThe presentation focus on what technology are threaded and mature and applicable to improve reliability, efficiency and sustainability of any development
La cruz del cambioJohn GonzalezThis PowerPoint presentation introduces the idea of a Latino/a sacramental theology that responds to changing times. It explores the emerging cosmological context of dynamic change and transition. Latino/a spirituality emphasizes redemptive suffering and solidarity in response to this context. Key aspects include witnessing grace through human experiences, a popular theology grounded in daily life, and an aesthetic cosmology of interconnection. Sacraments can acknowledge transition and death as passages to new life through communal accompaniment and shared suffering.
I camsmrdibyenduiCAMS is an Institute and Campus Advance Management System that provides a comprehensive software solution for educational institutions to manage their administration, academics, finance and operations. The software handles all core functions of a school or college including student admission, attendance, exams, grades, online fee payment, accounting, HR and payroll. iCAMS aims to automate institutional processes and information management to bring more efficiency through an integrated campus management system.
Papa Ratzinger vs Dalai Lama: la rete vi vede cosìReputation ManagerAnalsi di Reputation Manager sulle identità digitali dei due personaggi a confronto, pubblicata sul mensile Espansione di Settembre 2012
Cv.Pablocalderon1Pablo Calderón SalazarThis document is the curriculum vitae of Pablocalderon, an industrial designer from Bogota, Colombia. It summarizes his educational and professional background. Pablocalderon obtained his bachelor's degree in industrial design from Jorge Tadeo Lozano University. His experience includes managing a bar, designing posters for a film festival, teaching design courses, and freelancing on projects in areas like scenic, textile, and academic design. The CV emphasizes his skills in conceptualizing and developing projects, as well as finding creative solutions to complex problems quickly.
Behavioral Marketing - Ask for Permission or Beg for ForgivenesskaeppnbjThe Internet is the most measurable mass media channel ever. Emerging technologies are increasing marketer’s ability to monitor and target lucrative customers, resulting in an ever-widening gap between what is possible, legal, and ethical. At the center of this gray area is Behavioral Marketing, an approach that leverages technology to deliver targeted advertising messages based on a consumer’s demonstrated actions and predicted affinities. As the legal treatments of this topic vary greatly across nations, advertisers face a difficult decision.
Factors And MultiplesmmeddinFactors are numbers that divide another number with no remainder. Multiples are numbers produced by multiplying another number by 1 or more. The document provides examples of factors of 36 and instructs to list factors of 15 and 18. It defines multiples as products of a number and a non-zero whole number, giving examples for 4 and 3, and then instructs to list the next three multiples of 7 and 9.
How Did Economists Get It So WrongHoracio MadkurThe document summarizes an article about how economists failed to predict the recent financial crisis. It discusses how economists became overconfident, believing they had resolved their internal disputes and "solved" problems like preventing depressions. This vision failed to account for irrational behavior, market imperfections, and the possibility of economic crashes. The crisis exposed deep fault lines as economists disagreed strongly on how to respond. The profession will need to adopt a more realistic and cautious approach acknowledging the complexity and unpredictability of economic systems.
Corporate lessonsDeepty Chauhan The document provides three corporate lessons through short stories with morals. The lessons are: 1) One must be in a high position to be idle; 2) While bullshit can get you to the top, it won't keep you there; 3) Not all who help you are friends, and in trouble keep silent. The stories use animals like crows, turkeys and birds to represent corporate lessons about change, ambition and dealing with challenges.
World war 2ham97After invading Poland in 1939, Germany next invaded France. The Germans used a new rapid military tactic called "Blitzkrieg" or lightning war in Poland. The USSR and Germany signed a non-aggression pact agreeing not to attack each other. In 1940, over 400,000 British and French soldiers were evacuated from Dunkirk back to Britain. The Battle of Britain primarily involved aircraft. Besides Germany, the USSR also invaded Poland in 1939 according to the terms of the Molotov-Ribbentrop Pact signed by Germany and the USSR.
ExponentsmmeddinExponents represent repeated multiplication of a base number. An exponent tells how many times the base number is used as a factor. For example, in the expression 53, 5 is the base and 3 is the exponent, meaning 5 x 5 x 5 or 125. Any number to the 0 power equals 1, and any number to the 1st power equals itself. It is a common mistake to think the exponent indicates the number of factors instead of the number of times the base is used as a factor.
Bis Data InformationparamalwaysThe document defines key terms related to data, information, knowledge, and information systems. It states that data are raw facts, information is organized data, and knowledge is information made useful to support tasks or decisions. An information system is described as a set of interrelated components that includes inputs, processing, outputs, and feedback to meet objectives. The value of information is discussed as helping decision makers achieve goals and decide on investments.
Top sandwich companies in quick serviceAmit Kumar DasThe document discusses the top three sandwich companies in the quick service segment - Subway, Arby's, and Quiznos. It provides an overview of each company's industry, ownership structure, key events in their history, typical store characteristics and business strategies. Subway is the largest chain by units focusing on customized sub sandwiches. Arby's specializes in slow-roasted roast beef and turkey sandwiches. Quiznos offers made-to-order toasted subs, soups and salads. Information on each company's founders, franchise model, and recent acquisitions/rebranding is also summarized.
NECDM Group Newsletter 37 November 2009tracywatersThe newsletter provides information on recent health and safety prosecutions, campaigns, and events. It summarizes a prosecution of a company and director for a fall from height incident during roof repairs. It also announces an partnership with Build Safe UAE to share health and safety information. Finally, it previews an upcoming seminar on emergency planning and advertises for article submissions.
IIRSM_March2013_lowresNisa Gina CareyFour miners died when Gleision Colliery in South Wales flooded in 2011. The mine manager Malcolm Fyfield faces four counts of gross negligence manslaughter and the mine owner MNS Mining faces four counts of corporate manslaughter over the incident. A retaining wall failed, flooding the mine with over 500,000 gallons of water within three minutes. A major rescue operation was launched but the miners' bodies were only recovered the next day. The Crown Prosecution Service concluded there was sufficient evidence to charge Fyfield and MNS Mining.
NE Construction Newsletter July 2011 Debbie Flynn (2)Alan BassettThe document is a newsletter from the HSE Construction Division providing updates on health and safety regulations and recent incidents in the construction industry. It discusses the government's Red Tape Challenge to simplify regulations while supporting business growth. It also reports that fatal injuries in construction increased last year, with 8 deaths from structural collapses. Finally, it summarizes recent prosecutions of construction companies for safety violations that led to worker injuries.
Newcastle Construction Division Newsletter Issue No.9Alan Bassett(1) Asbestos remains a major workplace hazard, with over 35,000 deaths in Britain between 1977 and 2007 from asbestos-related diseases like mesothelioma. Asbestos awareness campaigns aim to educate workers about risks and how to identify and safely handle asbestos materials.
(2) Falls from ladders are a leading cause of workplace injuries and deaths, averaging 12 deaths and over 1,200 major injuries annually in Britain. The HSE advises that ladders only be used for short-duration, low-risk work like maintenance, and examples are given of accidents resulting from unsafe ladder use.
(3) The newsletter provides updates on recent HSE guidance and resources on managing work at
Aaron Anderson Legal considerations for workplaces of tomorrow (Implications ...Australian Institute of Health & SafetyThis document summarizes key topics from a legal safety symposium, including:
1) Recent industrial manslaughter cases in Australia, including the largest penalty imposed on Dreamworld theme park and charges brought against a Gympie business owner.
2) A case where a principal contractor was found responsible for a subcontractor's safety failures, highlighting an obligation to ensure subcontractor safety.
3) Growing risks around prosecution of individuals for workplace safety breaches and recognition of psychosocial risks to worker mental health.
HSE Safety Cornerstones - August 2017Gary ChambersThe HSE recently published provisional statistics for work-related fatal accidents between April 2016 and March 2017, which continued a 20-year trend of declining fatality rates. However, 137 workers were killed and 92 members of the public were fatally injured in work-related accidents. The statistics showed lower deaths than average in construction, agriculture, and manufacturing but higher deaths in waste and recycling. Companies are advised to periodically inspect risk management efforts to identify hazards and address potential issues in order to bolster health and safety policies and protect employees.
Newcastle Construction Division Newsletter-July 2010Alan BassettThe newsletter provides information on recent health and safety issues from the UK Health and Safety Executive's Construction Division. It discusses a decline in construction worker fatalities, the HSE's plans to target specific safety issues like asbestos and work at height, and new guidance materials for small construction sites. It also warns of dangers like broken cab windows on telehandlers and entrapment hazards in mobile elevating work platforms. Recent prosecutions of construction firms that failed to properly manage asbestos risks or trench wall collapses are also summarized.
La cruz del cambioJohn GonzalezThis PowerPoint presentation introduces the idea of a Latino/a sacramental theology that responds to changing times. It explores the emerging cosmological context of dynamic change and transition. Latino/a spirituality emphasizes redemptive suffering and solidarity in response to this context. Key aspects include witnessing grace through human experiences, a popular theology grounded in daily life, and an aesthetic cosmology of interconnection. Sacraments can acknowledge transition and death as passages to new life through communal accompaniment and shared suffering.
I camsmrdibyenduiCAMS is an Institute and Campus Advance Management System that provides a comprehensive software solution for educational institutions to manage their administration, academics, finance and operations. The software handles all core functions of a school or college including student admission, attendance, exams, grades, online fee payment, accounting, HR and payroll. iCAMS aims to automate institutional processes and information management to bring more efficiency through an integrated campus management system.
Papa Ratzinger vs Dalai Lama: la rete vi vede cosìReputation ManagerAnalsi di Reputation Manager sulle identità digitali dei due personaggi a confronto, pubblicata sul mensile Espansione di Settembre 2012
Cv.Pablocalderon1Pablo Calderón SalazarThis document is the curriculum vitae of Pablocalderon, an industrial designer from Bogota, Colombia. It summarizes his educational and professional background. Pablocalderon obtained his bachelor's degree in industrial design from Jorge Tadeo Lozano University. His experience includes managing a bar, designing posters for a film festival, teaching design courses, and freelancing on projects in areas like scenic, textile, and academic design. The CV emphasizes his skills in conceptualizing and developing projects, as well as finding creative solutions to complex problems quickly.
Behavioral Marketing - Ask for Permission or Beg for ForgivenesskaeppnbjThe Internet is the most measurable mass media channel ever. Emerging technologies are increasing marketer’s ability to monitor and target lucrative customers, resulting in an ever-widening gap between what is possible, legal, and ethical. At the center of this gray area is Behavioral Marketing, an approach that leverages technology to deliver targeted advertising messages based on a consumer’s demonstrated actions and predicted affinities. As the legal treatments of this topic vary greatly across nations, advertisers face a difficult decision.
Factors And MultiplesmmeddinFactors are numbers that divide another number with no remainder. Multiples are numbers produced by multiplying another number by 1 or more. The document provides examples of factors of 36 and instructs to list factors of 15 and 18. It defines multiples as products of a number and a non-zero whole number, giving examples for 4 and 3, and then instructs to list the next three multiples of 7 and 9.
How Did Economists Get It So WrongHoracio MadkurThe document summarizes an article about how economists failed to predict the recent financial crisis. It discusses how economists became overconfident, believing they had resolved their internal disputes and "solved" problems like preventing depressions. This vision failed to account for irrational behavior, market imperfections, and the possibility of economic crashes. The crisis exposed deep fault lines as economists disagreed strongly on how to respond. The profession will need to adopt a more realistic and cautious approach acknowledging the complexity and unpredictability of economic systems.
Corporate lessonsDeepty Chauhan The document provides three corporate lessons through short stories with morals. The lessons are: 1) One must be in a high position to be idle; 2) While bullshit can get you to the top, it won't keep you there; 3) Not all who help you are friends, and in trouble keep silent. The stories use animals like crows, turkeys and birds to represent corporate lessons about change, ambition and dealing with challenges.
World war 2ham97After invading Poland in 1939, Germany next invaded France. The Germans used a new rapid military tactic called "Blitzkrieg" or lightning war in Poland. The USSR and Germany signed a non-aggression pact agreeing not to attack each other. In 1940, over 400,000 British and French soldiers were evacuated from Dunkirk back to Britain. The Battle of Britain primarily involved aircraft. Besides Germany, the USSR also invaded Poland in 1939 according to the terms of the Molotov-Ribbentrop Pact signed by Germany and the USSR.
ExponentsmmeddinExponents represent repeated multiplication of a base number. An exponent tells how many times the base number is used as a factor. For example, in the expression 53, 5 is the base and 3 is the exponent, meaning 5 x 5 x 5 or 125. Any number to the 0 power equals 1, and any number to the 1st power equals itself. It is a common mistake to think the exponent indicates the number of factors instead of the number of times the base is used as a factor.
Bis Data InformationparamalwaysThe document defines key terms related to data, information, knowledge, and information systems. It states that data are raw facts, information is organized data, and knowledge is information made useful to support tasks or decisions. An information system is described as a set of interrelated components that includes inputs, processing, outputs, and feedback to meet objectives. The value of information is discussed as helping decision makers achieve goals and decide on investments.
Top sandwich companies in quick serviceAmit Kumar DasThe document discusses the top three sandwich companies in the quick service segment - Subway, Arby's, and Quiznos. It provides an overview of each company's industry, ownership structure, key events in their history, typical store characteristics and business strategies. Subway is the largest chain by units focusing on customized sub sandwiches. Arby's specializes in slow-roasted roast beef and turkey sandwiches. Quiznos offers made-to-order toasted subs, soups and salads. Information on each company's founders, franchise model, and recent acquisitions/rebranding is also summarized.
NECDM Group Newsletter 37 November 2009tracywatersThe newsletter provides information on recent health and safety prosecutions, campaigns, and events. It summarizes a prosecution of a company and director for a fall from height incident during roof repairs. It also announces an partnership with Build Safe UAE to share health and safety information. Finally, it previews an upcoming seminar on emergency planning and advertises for article submissions.
IIRSM_March2013_lowresNisa Gina CareyFour miners died when Gleision Colliery in South Wales flooded in 2011. The mine manager Malcolm Fyfield faces four counts of gross negligence manslaughter and the mine owner MNS Mining faces four counts of corporate manslaughter over the incident. A retaining wall failed, flooding the mine with over 500,000 gallons of water within three minutes. A major rescue operation was launched but the miners' bodies were only recovered the next day. The Crown Prosecution Service concluded there was sufficient evidence to charge Fyfield and MNS Mining.
NE Construction Newsletter July 2011 Debbie Flynn (2)Alan BassettThe document is a newsletter from the HSE Construction Division providing updates on health and safety regulations and recent incidents in the construction industry. It discusses the government's Red Tape Challenge to simplify regulations while supporting business growth. It also reports that fatal injuries in construction increased last year, with 8 deaths from structural collapses. Finally, it summarizes recent prosecutions of construction companies for safety violations that led to worker injuries.
Newcastle Construction Division Newsletter Issue No.9Alan Bassett(1) Asbestos remains a major workplace hazard, with over 35,000 deaths in Britain between 1977 and 2007 from asbestos-related diseases like mesothelioma. Asbestos awareness campaigns aim to educate workers about risks and how to identify and safely handle asbestos materials.
(2) Falls from ladders are a leading cause of workplace injuries and deaths, averaging 12 deaths and over 1,200 major injuries annually in Britain. The HSE advises that ladders only be used for short-duration, low-risk work like maintenance, and examples are given of accidents resulting from unsafe ladder use.
(3) The newsletter provides updates on recent HSE guidance and resources on managing work at
Aaron Anderson Legal considerations for workplaces of tomorrow (Implications ...Australian Institute of Health & SafetyThis document summarizes key topics from a legal safety symposium, including:
1) Recent industrial manslaughter cases in Australia, including the largest penalty imposed on Dreamworld theme park and charges brought against a Gympie business owner.
2) A case where a principal contractor was found responsible for a subcontractor's safety failures, highlighting an obligation to ensure subcontractor safety.
3) Growing risks around prosecution of individuals for workplace safety breaches and recognition of psychosocial risks to worker mental health.
HSE Safety Cornerstones - August 2017Gary ChambersThe HSE recently published provisional statistics for work-related fatal accidents between April 2016 and March 2017, which continued a 20-year trend of declining fatality rates. However, 137 workers were killed and 92 members of the public were fatally injured in work-related accidents. The statistics showed lower deaths than average in construction, agriculture, and manufacturing but higher deaths in waste and recycling. Companies are advised to periodically inspect risk management efforts to identify hazards and address potential issues in order to bolster health and safety policies and protect employees.
Newcastle Construction Division Newsletter-July 2010Alan BassettThe newsletter provides information on recent health and safety issues from the UK Health and Safety Executive's Construction Division. It discusses a decline in construction worker fatalities, the HSE's plans to target specific safety issues like asbestos and work at height, and new guidance materials for small construction sites. It also warns of dangers like broken cab windows on telehandlers and entrapment hazards in mobile elevating work platforms. Recent prosecutions of construction firms that failed to properly manage asbestos risks or trench wall collapses are also summarized.
Newcastle Construction Division Newsletter July 2010 Debbie FlynnAlan BassettFewer construction workers killed in past year...HSE Construction Division Plan of Work 2010-11...New Information Sheets – What you need to know as a busy builder...Recent Prosecutions
Construction firms sentenced after worker deathnwroffingcompanyA national construction firm and a glazing contractor have been sentenced after pleading guilty to s...
Healthsafekennylieske- Health and safety legislation has evolved significantly over thousands of years from Hammurabi's Code of Law in ancient Mesopotamia to modern UK law.
- The Health and Safety at Work Act of 1974 established employers' duty of care for employees' health, safety and welfare and required risk assessments, competent appointments, training and policies.
- Employers must manage risks like fire, workstations, manual handling, asbestos and report deaths, injuries and incidents to the Health and Safety Executive.
- Senior management can face criminal charges for failings resulting in death.
BIFM Presentation 261115 (2)Peter W Hall MA CMIOSH FIIRSM FIoDThis document discusses contractor safety and risk management. It begins with an introduction and definitions of contractors. It then discusses why managing contractors is important, citing an example where lack of oversight led to costly damages. The document outlines steps for contractor selection and assessment, as well as relevant UK health and safety laws. It provides two case studies where contractors were prosecuted for safety violations. Finally, it previews potential changes to UK sentencing guidelines to increase fines for health and safety offenses that create risk of harm. The overall message is that properly planning, selecting, communicating with, monitoring, and signing off on contractors is needed to manage safety risks.
CIBSE South West LEV Presentation. Part 1Adrian SimsThis document provides an overview of a presentation on understanding and designing local exhaust ventilation (LEV) systems. It discusses why LEV is important for health and safety reasons, providing statistics on occupational illness and costs. It also covers relevant legislation, examples of LEV systems, and highlights issues with many current LEV installations. The presentation aims to help attendees properly assess risks, select, commission and maintain LEV controls as required by regulations.
Live events technical production v2 module 1and 2Martin Barraclough GradIOSHThis document provides an overview and summary of Module 1 - Organising for Safety from a training course on safety for the live event technical production sector. The module covers Construction Design and Management (CDM) regulations and responsibilities, an overview of key health and safety law including employer, employee and enforcing authority responsibilities. It also addresses hazards and risks, the risk assessment process, and gives examples of enforcement actions and penalties for safety violations.
Health and safety at workReece HancockThe document summarizes the key aspects and history of health and safety legislation in the UK, including the Health and Safety at Work Act of 1974. It established general duties for employers and employees, and created the Health and Safety Executive body to regulate workplace health, safety, and welfare. The legislation set a basic principle that health and safety is a shared responsibility and introduced regulations around risk assessment, accident investigations, enforcement, and penalties.
Introduction to occupational safety and healthPoliteknik Kuching SarawakThis document provides an introduction to occupational safety and health (OSH) regulations. It defines OSH as protecting worker safety, health, and welfare. The goals of OSH programs are to foster a safe work environment. OSH may also protect others affected by the workplace. The document outlines the history and evolution of OSH legislation in Malaysia from 1844 to present day laws. It also discusses why safety is important in the workplace and defines key safety terminology like hazards, risks, incidents, and accident costs. Types of frequent workplace accidents like falls, crushing, manual handling, and traffic are listed. Finally, readers are prompted to identify hazards in an example picture.
UK Pulse Issue 4Gordonmac25This newsletter summarizes recent achievements and events within the UK operations of Wood Group PSN. It discusses two significant contract wins in the first half of the year with Talisman Sinopec Energy UK and Chevron North Sea Limited. It also mentions the restructuring of the UK team and partnership with Sulzer Wood. Additionally, it provides updates on community fundraising efforts that have raised over £50,000 for various causes. Finally, it discusses the company's success in various industry awards, with 13 nominations and 2 wins.
What is safety 1 convertedveera maheshThis document discusses workplace safety. It begins by defining safety and listing types of safety like plant, worker, and consumer safety. It then provides a history of safety laws and regulations in the UK and other countries dating back to the early 19th century. Regulations focused initially on child labor and later expanded to other industries like mining. Key acts and agencies governing occupational safety are mentioned for the US and other countries. Common hazards, causes of accidents, and safety management approaches like risk assessment and a safety culture are outlined. The goals of health and safety efforts are also stated as training workers and preventing incidents and injuries.
Roman Catholic Church of OurLady of MuswellJan AlvinoThe document summarizes an asbestos removal project conducted by Amiante STR Limited at the Roman Catholic Church of Our Lady of Muswell in North London. Amiante STR Limited was contracted to remove redundant asbestos insulated pipework running above the roof of the old boiler house. The removal required planning, risk assessments, scaffolding, and air clearance tests due to the hazardous nature of the asbestos materials. Amiante STR Limited is an asbestos licensed contractor capable of conducting asbestos surveys, removals, training, and consultancy to ensure projects are managed safely.
Emergency organization in underground coal mine with indian case studies.pptxNitesh Kumar Shah student @IITBHUEmergency organization in underground coal mine with indian case studies detail report.
1. NorthEastSafetyGroupsNewsletter
June2009
1) MovingGoodsSafelySeminar
A meeting of the Working Party was held on Tuesday 28th April 2009, when the
followingdecisionsweremade:‐
Delegate Fee to be £25 per person; Exhibitors Fee £150; Event to be held Mid
November. Four locations are being looked at as possible venues to compare
costing&availability.
Wewillkeepyouuptodateasthematterprogresses.
2) FallingMDFboardskillapprentice
TheapprenticewasworkingattheChrisPridmoreJoineryLtdworkshops,whena
stack of MDF boards fell on him. He died later in hospital from serious head
injuries.Thecompanywasfined£7,500andorderedtopaycostsof£2,500after
pleadingguiltytobreachingtheProvision &UseatWorkEquipmentRegulations
1998.Theboardswerestoredontopofabenchintheworkshopandfellbecause
a bracket that was intended to restrain them was not strong enough to support
theirweight.Thebracketfailedafteronlyaweekinuse.
3) Firmfinedaftertwoaccidentsinthreemonths
A North East Manufacturing firm has been fined more than £25,000 after two
accidentsinthreemonthsleftoneworkerneedinghislegamputatedandanother
withseriouscrushinjuries.EggerUKLtd,achipboardmanufacturer,pleadedguilty
tosixhealthandsafetychargesfollowingtheaccidentsinMayandAugust2007.It
wasfined£25,400withcostsof£11,881.00,withavictimsurchargeof£15.00.
HSE Inspector Bruno Porter said “Employers must prevent or control risks to
people’shealthfromequipmenttheyuseatwork:Anemployermustensurethat
appropriateriskassessmentshavebeencarriedout,andthatallworkequipment
is suitable for use. Any assessment and safe working practice must include safe
isolationofallsourcesofenergy,electrical&mechanical”.
4) KeithBassendineITC(IndependentTrainingConsultant)
“Doyouhaveahealthandsafetyproblem”–ifsowecandesignatrainingcourse
tomeetyourneeds.OurCompanyareextremelycompetitive,costeffectiveand
flexibletosuityourcompaniesbusyworkschedule.
CCNSGNationallyAccreditedSafetyPassport
ManualHandlingInstructor/Assessor
PeopleHandlingInstructor/Assessor
RiskAssessor
COSHHAssessor
SafeWorkingatHeights
ConfidenceBuildingCourses
Ifyouhaveanyothersafetyrequirementspleasecontactuson:‐
Tel:01642458230Mobile:07958713929orEmail:kbassendine@ntlworld.com
2. NorthEastSafetyGroupsNewsletter
June2009
5) Steelyardfinedafterseriousaccident
AHullfirmhasbeenfined£8,000with£2,195.00costsafteranaccidentinwhicha
warehousemanwasseriouslyinjuredbyfallingsteelbars.Theemployeewasusing
aradio‐controlledoverheadcranetotransfersteelbarsfromthefloortorackingin
thefirmswarehousewhenbundlesofsteelbarsbecamedislodged,breakingboth
his legs and crushing his ankle. The court heard that guidance for storing and
stackingsteelbarshadnotbeenfollowed.
6) Morrison’sadmitssafetycharge
Morrison’sthesupermarketchainhasbeenfined afteranemployee’seyeswere
injuredbyachemicalcleanerthatsquirtedintohereyesfromafaultydispenser.A
manager at the store had been exposed to the same chemical the day before
when using the same defective dispenser. The company was fined £18,000 with
costs of £2,954.00 after pleading guilty to offences under HASAWA 1974 and
COSHH.
7) Councilfinedfollowingdeathofwastecollector
A local authority was fined £13,500.00 after pleading guilty to a charge under
section2(1)ofHASAWA1974.Theaccidenthappenedastheemployeewhowas
working as a waste recycling collector was run over by the council’s waste
recycling lorry which was reversing. He was fatally injured. The HSE has warned
employersofwastecollectorstoensuretheirkerbsideworkersarefullytrainedto
safelyassisttheirdriverstoreverse.
8) TeessideSafetyGroupAGM
At the above meeting held on Tuesday 19th May 2009, the Treasurer stated the
Group had £14,994.23 in the bank. The programme for July 2009 – June 2010 is
nowbeingcompiledandwearesurethecontentswillmeetwithyoursatisfaction
andlookforwardtoyourcontinuedsupport.ThethanksoftheGroupweregiven
to Anne Pennock (Mouchel) for the excellent administration service she gives to
theGroup.Wehavelost22Membersduetotherecessionbuthavesofargained
8newmembers.
ThefollowingmembersoftheCommitteewerere‐elected:‐
Chairman– PaulSmith
Secretary– KeithDavison
Treasurer– MauriceAdamson
OrganisingSecretary– StevePiper
Promotion/Publicity– AlanBassett
Committee– JohnRaftery
MrsRozElms
Co‐optedMembers– PeterWalker(BCSA)
RobHirst(HSE)
3. NorthEastSafetyGroupsNewsletter
June2009
9) Constructionworkersuffersseriousheadinjuries
HSE has warned the construction industry about the need to properly manage
working at height, following the prosecution of the principal contractor on
Europe’s largest city centre regeneration project. The warning follows the
prosecution of Laing O’Rourke Construction Ltd, after one of its employees fell
more than 3 metres during the construction of concrete stairs inside one of the
main apartment blocks on the project. He suffered multiple, serious head and
otherinjuriesandnarrowlyescapedfalling3floorstothebaseofthebuilding.The
incident happened in Liverpool One, the new shopping and entertainment
development in Liverpool City Centre. The Company was fined £80,000 and
orderedtopay£10,000costs.
10) Workerengulfedinflames
A59‐year‐oldworkerwasengulfedinflameswhenaleakignitedaspetrolfroma
fuelretrievertankwasbeingtransferred.Theman’strousersweresetalightand
hesufferedsevereburnstothebacksofhislegsandtohishandsandarmsashe
wastryingtoriphistrousersoff.Herantoanearbytaptoputouttheflames.The
employeewasadmittedtohospitalfor5weeksandhadtohave2skingrafts.His
burns covered 17% of his body and he has not returned to work since. The
Companywasfined£2,000andorderedtopay£2,375.00costs.
11) Joineryfirmfinedoverscaffoldfall
Theincidenthappenedduringthefit‐outofashopaspartoftheconstructionofa
shopping centre. The injured person was working from a mobile tower scaffold
while fitting ducting for a shop when he fell 3 metres and suffered serious head
injuries. The Company was fined £20,000.00 and were also instructed to pay
£11,895.00costs.
12) Newguidancepublished
New guidance on managing skin exposure risks at work points out that many
materials used at work can affect the skin or pass through it and cause diseases
elsewhere in the body. The guidance recently published by the HSE is aimed at
employers, health and safety advisers, trainers and safety representatives; and
offerspracticaladvicetohelppreventsuchdisablingdiseases.
“ManagingSkinExposureRisksatWork”,HSG262canbeorderedfromHSEBooks
onTel.01787881165.
Thanks to Maurice Adamson for the time he spends reviewing many relevant
publicationstodevelopthisnewsletter.Thisenablesustogetonwithourdayto
dayactivitieswithoutmissingvaluableinformationandtimelyreminders…..!