The exam media
Download as PPTX, PDF0 likes284 views
The document summarizes the technical elements used in the short film "The Exam", including camera shots, editing techniques, sound, titles, codes and conventions, representation, audience, and themes. Camera shots included extreme close-ups, close-ups, and medium shots. Editing primarily used straight cuts and fades between shots. The film also includes dialogue, non-diegetic sounds, and diegetic sounds. It represents the characters through different camera shots and levels and includes stereotypes. The intended audience is teenagers and university students who can relate to the comedy genre and themes about working hard to succeed in life.
1 of 12
Download to read offline
Recommended
pros and cons 
pros and cons haverstockmedia
Ìý
This document discusses a student film project called "Suicidal Love" that will have a low budget since equipment will be provided by the student's school. Some potential issues are a lack of funds for all needed props and uncertainty over actor availability or weather interfering with filming. To overcome these challenges, the student plans to raise money collectively for props, check the weather ahead of time, and have understudies available in case main actors cannot make it to filming.Casting
CastingJessWhiteMEDIA
Ìý
The document discusses casting choices for roles in a new film. It describes six actors being considered - Sean, Lucy, Radika, Matthew, Lee, and Ryan. For each it provides their name, date of birth, character they would play, and strengths and weaknesses relevant to the role. The strengths and weaknesses provide justification for why each actor was chosen and potential issues that may arise during filming. The roles include an attractive male lead, a professional experienced actress, an inexperienced actress playing a geeky role, a less attractive male to not overshadow the lead, and an actor playing a comedic cross-dressing role due to their short stature. Diversity among the actors is intended to follow comedy film conventions andCasting
CastingJessWhiteMEDIA
Ìý
The document discusses casting choices for roles in a new film. It describes six actors being considered - Sean, Lucy, Radika, Matthew, Lee, and Ryan. For each it provides their name, date of birth, character they would play, and strengths and weaknesses relevant to the role. The strengths and weaknesses provide justification for why each actor was chosen and potential issues that may arise during filming. Overall the document aims to cast roles following comedy film conventions to attract the target teenage female audience.Genre research
Genre researchmitch1598
Ìý
This document discusses the genre conventions of action/thriller films that the author researched in order to create an opening sequence for their film "Dead End." It describes conducting surveys that found action to be the most popular genre. It outlines the transitions, sounds, lighting, and mise-en-scene elements they chose based on conventions from films like The Dark Knight and Taken. While some elements oppose conventions to be unexpected, the sequence overall aims to match the fast-paced suspense typical of the action/thriller genre.Micro and Macro elements
Micro and Macro elementsGirish Jeebodhun
Ìý
Micro/Macro Elements outlines key components of filmmaking at both the micro and macro levels. At the micro level, it discusses cinematography techniques like camera angles and movements, mise en scene elements like lighting, costumes, and props, sound design choices, and editing styles. At the macro level, it covers narrative structures, common film genres, representations of gender and class in films, and how producers aim to appeal to targeted audiences.How did you attract the adience
How did you attract the adience07twise
Ìý
The document discusses how the opening film uses genre, narrative, and style to attract the audience. It establishes the genre as a teen film set in college by using a montage of clips around the college. It slowly introduces the first location and characters through pans and tilts. It hooks the audience by setting the scene in a college setting but creates disequilibrium by showing a character holding a knife, suggesting a horror genre.What makes a good opening sequence...?
What makes a good opening sequence...?guestb419e3
Ìý
The document discusses what makes a good film opening through analyzing the opening of the film Love and Basketball. It summarizes that the opening is cleverly divided into four quarters like a basketball game. It introduces the setting with extreme long shots and shows a character moving with a long shot of a van being unpacked. The camera placements and character costumes are relevant and help reveal clues about the characters. It leaves the viewer wanting to know what happens next.Toy story
Toy storykimberley2911
Ìý
The document outlines Vladimir Propp's model of character functions in folktales. It identifies 7 main character types: 1) The Villain who struggles against the Hero, 2) The Magical Helper who helps the Hero, 3) The Princess or Prize that is the reward for defeating the Villain, 4) The Father who gives tasks or marries the Hero, 5) The Donor who gives magical gifts, 6) The Hero or Victim, and 7) The False Hero. It then provides examples of these characters types from the story Toy Story. Production Evaluation
Production EvaluationElliott Wigmore
Ìý
My opening sequence follows conventions of real opening sequences in several ways:
1) It introduces the title and opening credits in a linear fashion before showing the first scene, to clearly introduce the production and begin developing the story.
2) Elements like location, costumes, characters and cinematography reflect conventions of the horror genre, such as an isolated dark woods setting, typical teenage clothing, and limited views of the threatening creature.
3) The narrative structure uses techniques like flash forwards and a light/dark binary opposition that are common in horror and help build tension, while maintaining audience interest in the characters and plot.Understanding of camera shots
Understanding of camera shotsdaniellemerrikin
Ìý
This document defines and provides examples of different types of camera shots, including extreme close-ups, close-ups, medium shots, long shots, extreme long shots, tracks, pans, tilts, zooms, and cuts. An extreme close-up focuses on small details like eyes or blades. Close-ups show objects or a person's face in more detail. Medium shots capture the upper half of a person. Long shots show a full person and their surroundings. Extreme long shots establish a scene's setting from a distance. Tracks follow objects or people moving. Pans rotate the camera horizontally. Tilts move the camera vertically. Zooms focus on distant subjects or people. Cuts transition between scenes.Film language
Film languageMelanie Vaca Arango
Ìý
This document discusses different types of film shots and how they are used to create meaning. It analyzes tracking shots, leading shots, tilt shots, over the shoulder shots, and two shots used in a short film project. Tracking shots follow a moving subject to create suspense and involvement. Leading shots use continuity to show a character in action. Tilt shots introduce a character's costume, props, and body language to demonstrate distress. Over the shoulder shots place characters in their setting during discussions. Two shots clearly show characters' body language, facial expressions, and location. Overall, the project successfully used these shots to capture the thriller/adventure genre and create meaning through visual storytelling.Forms and Conventions of Film Presentation.pptx
Forms and Conventions of Film Presentation.pptxsusiefallaria1
Ìý
The document provides an overview of key forms and conventions of film, including genres, cinematography techniques, editing, audio techniques, and theatrical elements. It discusses genres like action, drama, and horror. Techniques covered include shots, angles, lighting, editing approaches, uses of music and sound, and voice elements. Theatrical elements discussed include setting and location.Camera angles, shots and techniques
Camera angles, shots and techniquesellaponting
Ìý
This document discusses different camera shots and techniques used in filmmaking, including close-ups, extreme close-ups, mid-shots, two shots, long shots, extreme long shots, and point of view shots. Each shot type is defined and examples are provided of how each shot can be used to convey meaning, establish relationships between characters, set the scene or location, and engage or connect with the audience. The different shot types allow filmmakers to reveal varying levels of detail about characters, their emotions, surroundings, and interactions.Pre-liminary trailer task evaluation
Pre-liminary trailer task evaluationLucypankhurst
Ìý
The document provides an analysis of shots, camera movements, editing, music and pacing used in a teaser trailer for a film called "Escape". It describes various shots including mid shots, long shots and close ups used to introduce characters and set scenes. It also discusses camera pans, zooms and angles used to follow characters and build tension. The music is described as eerie and intensifying throughout the trailer to match the increasing suspense, though one section could have been a better fit. Overall the analysis evaluates techniques used to keep audiences engaged without revealing the full story.Preliminary Trailer Presentation
Preliminary Trailer Presentationsophieyates
Ìý
The document provides an analysis of the titles, shots, camera techniques, and music used in a teaser trailer for the horror film "Detension" about a student trapped in detention. Key elements include:
1) The title "Detension" is meant to imply tension and plays on the word detention.
2) Shots include a panning establishing shot of the school, a close-up of a detention slip, and shots of a character walking and opening a door to build tension.
3) Music starts distorted and unsettling, gets more tense as shots intensify, and builds to a climactic ending, helping move the plot and scare the audience.Camera shots and practice
Camera shots and practiceJJMurtagh5799
Ìý
The document discusses different types of camera shots used in filmmaking including establishing shots to set the scene, long shots to show characters in their environment, extreme close ups to focus on specific movements or reactions, low shots to make characters appear dominant, mid shots for general views of characters, and shot/reverse shot to capture interactions between characters.Micro Technical Analysis and Comparison to Focal Films
Micro Technical Analysis and Comparison to Focal Filmspaigeneilson
Ìý
The document discusses various cinematography techniques used in the filmmaker's short film and Terrence Malick films. It describes how extreme close-ups, close-ups, medium shots, and long shots were used to focus attention and provide context. It also discusses the use of natural lighting, shadows, and camera angles. The filmmaker aimed to reflect Malick's style through the use of wide-angle lenses, locations representing freedom and nature, and montage editing sequences. Only diegetic sound from a song was used to reflect the influences of silent films.Camera work in pyschological and stalker horror film (without trailers)
Camera work in pyschological and stalker horror film (without trailers)Lauren Stockdale
Ìý
The document discusses various camera shot types and movements used in psychological and stalker horror film trailers. It analyzes shots like aerial shots, master shots, close-ups, over the shoulder shots, two shots, point of view shots, tracking shots, low angle shots, extreme close-ups, panning, zooming, and depth of field. It notes that these shots are used to set the scene, show characters' emotions and reactions, develop relationships, create tension, emphasize power dynamics, and direct the viewer's focus. The document concludes that point of view shots are particularly effective in these genres as they immerse the viewer in the character's perspective.Hot fuzz film opening analysis
Hot fuzz film opening analysisSolo Hickey
Ìý
This document analyzes the cinematography techniques used in the opening sequence of the film Hot Fuzz. It discusses how various shots like extreme long shots, medium shots, and close-ups are used to build suspense around the main character and establish him as a serious and accomplished police officer, despite hints that the film will have comedic elements. Transitions between shots use flashes or match cuts to keep the sequence intense as the character's backstory and achievements are laid out. The cinematography and narration work together to present the main character as a perfect officer before the absurd comedy of the film is revealed.Micro elements
Micro elementssimply24
Ìý
This document discusses various micro elements used in film openings, including shots like extreme close-ups, close-ups, medium shots, and long shots. It also covers camera movements like pans, tilts, tracks, and zooms. Additional elements discussed are pace, performance, diegetic and non-diegetic sound, and mise-en-scene.Kane gibbons conventions question main
Kane gibbons conventions question mainkanegibbons1
Ìý
The document discusses conventions of film narratives and how the author's short film compares. It begins by outlining Todorov's narrative theory of equilibrium disruption-climax-resolution. It analyzes the 2008 film Taken as an example. The author's narrative follows conventions at first but breaks from expectations by having the protagonist fail to communicate with the woman due to a language barrier. The document also discusses conventional camera shot sizes and how the author incorporated standard shots as well as innovative shots like through a beer glass. Regarding sound, it notes challenges of low-budget production but how the author overcame this through enhanced dialogue recording and an artificial sound overlay.Question 7 neww
Question 7 newwJemPinto
Ìý
The document summarizes the filming and editing process for a group project, noting several flaws. Planning helped with scenes and continuity, but more practice was needed for filming and editing skills. Shots were established to set the location and introduce characters, but errors were made regarding continuity of door positions between shots. Reaction shots were missing that would have improved the dialogue scenes. Issues with leg positioning and clarity of a bite wound highlight flaws in maintaining the 180 degree rule during editing.Film language
Film languageclarkelucy2051
Ìý
The document defines several key terms related to film language, including opening sequences, diegesis, synchronous and asynchronous sound, parallel and contrapuntal sound, shot types, camera movements, and mise-en-scene. An opening sequence should introduce characters, location, genre, and a hook. Diegesis refers to everything visible within the film. Synchronous sound fits the on-screen action while asynchronous does not. Parallel sound matches mood and contrapuntal contrasts it. Shot types convey distance and camera movements create dynamics. Mise-en-scene encompasses visual elements that enhance storytelling.Snap
Snapsarahfeeman1993
Ìý
This document provides a detailed textual analysis of the short film "Snap" in 3 sections:
1. Micro analysis of camera techniques, shot types, movement, framing and depth of field.
2. Macro analysis of genre codes/conventions and how expectations are satisfied.
3. Narrative analysis of perspective, time representation, character roles, and structure.
The analysis finds that simple concepts and original ideas work best, and characters are not always the most essential element. Techniques like tracking shots and slow motion are effectively used to convey meaning. Overall it provides insights into short film techniques that could influence the reviewer's own productions.Camera shots camera movements camera angles
Camera shots camera movements camera anglesTafi123
Ìý
The document discusses various camera techniques used in filmmaking including shots, angles, movements, and lighting. It provides definitions and examples of different shot types like extreme long shot, long shot, mid shot, and close-up. It also defines high angles, eye-level angles, and low angles. Camera movements like panning, tracking shots, and dolly shots are explained. The document stresses that these techniques are used purposefully by filmmakers to shape meaning and influence the audience.Film language 
Film language Boluwatifé Famodun
Ìý
This document provides descriptions and examples of different types of camera shots that can be used in filmmaking. It discusses shots like the over the shoulder shot, close-up, tilt shot, two-shot, and zoom in/out shots. It explains how each shot is composed and the purpose it serves, such as showing facial expressions, introducing characters, or depicting conversations. The document also summarizes a task where the author captured various shots with a camera group and learned about selecting shots to emphasize genre and tell a film's story.Representation in films
Representation in filmsBeckyMoffatASMedia
Ìý
The document discusses representations of teenagers in the opening scenes of two films: Clueless and Submarine.
The opening of Clueless uses bright colors, high key lighting, fast editing and a lively song to represent the teenage characters as happy and interested in partying rather than school. This provides a negative representation that is hard for audiences to relate to.
In contrast, the opening of Submarine uses low key lighting, close-ups of a character looking blankly, high angles and fast pacing to suggest the main character feels small and isolated living a fast-paced but anxious life. Non-diegetic bird sounds imply a quiet, isolated setting representing lonely teenagers. The protagonist also speaks in a monotLesson 12 - Animation.pptxHJSDFHHJKFKFGGHHFKHKF
Lesson 12 - Animation.pptxHJSDFHHJKFKFGGHHFKHKFDwayneAshleySilvenia
Ìý
,JHFZXKfDKFsKDJSAHDFSHFDHSAHDFJKhhfGD VKYTKVEYTWKYTRKYTWQYTDYASTGDHFASDJHjhfkeydFKYRFKYWETKUTFKyagskjhdftfkuytwqekytrywtqkuyProp list
Prop listoliviafarrell
Ìý
The document lists home office equipment including a keyboard, monitor, printer, telephone and wall mounted clock. It also lists a container of assorted sweets and a pair of black heels. The items are numbered for inventory purposes.Costume list
Costume listoliviafarrell
Ìý
The document provides a costume list and analysis for a character named Carly featured in various film shots. It describes the clothing, accessories, and colors used for Carly in different scenes and explains the suggested meanings and story implications. For example, an outfit with a scarf and t-shirt in shots 1, 4, and 12 is meant to suggest cold weather and that Carly has something to hide. Another outfit featuring a coat, bag, and jeans in multiple shots emphasizes fashion but a cold environment. The various costumes are meant to subtly convey details about Carly's personality, emotional state, and the surrounding context through symbolic meanings of the clothing choices and colors.More Related Content
Similar to The exam media (20)
Production Evaluation
Production EvaluationElliott Wigmore
Ìý
My opening sequence follows conventions of real opening sequences in several ways:
1) It introduces the title and opening credits in a linear fashion before showing the first scene, to clearly introduce the production and begin developing the story.
2) Elements like location, costumes, characters and cinematography reflect conventions of the horror genre, such as an isolated dark woods setting, typical teenage clothing, and limited views of the threatening creature.
3) The narrative structure uses techniques like flash forwards and a light/dark binary opposition that are common in horror and help build tension, while maintaining audience interest in the characters and plot.Understanding of camera shots
Understanding of camera shotsdaniellemerrikin
Ìý
This document defines and provides examples of different types of camera shots, including extreme close-ups, close-ups, medium shots, long shots, extreme long shots, tracks, pans, tilts, zooms, and cuts. An extreme close-up focuses on small details like eyes or blades. Close-ups show objects or a person's face in more detail. Medium shots capture the upper half of a person. Long shots show a full person and their surroundings. Extreme long shots establish a scene's setting from a distance. Tracks follow objects or people moving. Pans rotate the camera horizontally. Tilts move the camera vertically. Zooms focus on distant subjects or people. Cuts transition between scenes.Film language
Film languageMelanie Vaca Arango
Ìý
This document discusses different types of film shots and how they are used to create meaning. It analyzes tracking shots, leading shots, tilt shots, over the shoulder shots, and two shots used in a short film project. Tracking shots follow a moving subject to create suspense and involvement. Leading shots use continuity to show a character in action. Tilt shots introduce a character's costume, props, and body language to demonstrate distress. Over the shoulder shots place characters in their setting during discussions. Two shots clearly show characters' body language, facial expressions, and location. Overall, the project successfully used these shots to capture the thriller/adventure genre and create meaning through visual storytelling.Forms and Conventions of Film Presentation.pptx
Forms and Conventions of Film Presentation.pptxsusiefallaria1
Ìý
The document provides an overview of key forms and conventions of film, including genres, cinematography techniques, editing, audio techniques, and theatrical elements. It discusses genres like action, drama, and horror. Techniques covered include shots, angles, lighting, editing approaches, uses of music and sound, and voice elements. Theatrical elements discussed include setting and location.Camera angles, shots and techniques
Camera angles, shots and techniquesellaponting
Ìý
This document discusses different camera shots and techniques used in filmmaking, including close-ups, extreme close-ups, mid-shots, two shots, long shots, extreme long shots, and point of view shots. Each shot type is defined and examples are provided of how each shot can be used to convey meaning, establish relationships between characters, set the scene or location, and engage or connect with the audience. The different shot types allow filmmakers to reveal varying levels of detail about characters, their emotions, surroundings, and interactions.Pre-liminary trailer task evaluation
Pre-liminary trailer task evaluationLucypankhurst
Ìý
The document provides an analysis of shots, camera movements, editing, music and pacing used in a teaser trailer for a film called "Escape". It describes various shots including mid shots, long shots and close ups used to introduce characters and set scenes. It also discusses camera pans, zooms and angles used to follow characters and build tension. The music is described as eerie and intensifying throughout the trailer to match the increasing suspense, though one section could have been a better fit. Overall the analysis evaluates techniques used to keep audiences engaged without revealing the full story.Preliminary Trailer Presentation
Preliminary Trailer Presentationsophieyates
Ìý
The document provides an analysis of the titles, shots, camera techniques, and music used in a teaser trailer for the horror film "Detension" about a student trapped in detention. Key elements include:
1) The title "Detension" is meant to imply tension and plays on the word detention.
2) Shots include a panning establishing shot of the school, a close-up of a detention slip, and shots of a character walking and opening a door to build tension.
3) Music starts distorted and unsettling, gets more tense as shots intensify, and builds to a climactic ending, helping move the plot and scare the audience.Camera shots and practice
Camera shots and practiceJJMurtagh5799
Ìý
The document discusses different types of camera shots used in filmmaking including establishing shots to set the scene, long shots to show characters in their environment, extreme close ups to focus on specific movements or reactions, low shots to make characters appear dominant, mid shots for general views of characters, and shot/reverse shot to capture interactions between characters.Micro Technical Analysis and Comparison to Focal Films
Micro Technical Analysis and Comparison to Focal Filmspaigeneilson
Ìý
The document discusses various cinematography techniques used in the filmmaker's short film and Terrence Malick films. It describes how extreme close-ups, close-ups, medium shots, and long shots were used to focus attention and provide context. It also discusses the use of natural lighting, shadows, and camera angles. The filmmaker aimed to reflect Malick's style through the use of wide-angle lenses, locations representing freedom and nature, and montage editing sequences. Only diegetic sound from a song was used to reflect the influences of silent films.Camera work in pyschological and stalker horror film (without trailers)
Camera work in pyschological and stalker horror film (without trailers)Lauren Stockdale
Ìý
The document discusses various camera shot types and movements used in psychological and stalker horror film trailers. It analyzes shots like aerial shots, master shots, close-ups, over the shoulder shots, two shots, point of view shots, tracking shots, low angle shots, extreme close-ups, panning, zooming, and depth of field. It notes that these shots are used to set the scene, show characters' emotions and reactions, develop relationships, create tension, emphasize power dynamics, and direct the viewer's focus. The document concludes that point of view shots are particularly effective in these genres as they immerse the viewer in the character's perspective.Hot fuzz film opening analysis
Hot fuzz film opening analysisSolo Hickey
Ìý
This document analyzes the cinematography techniques used in the opening sequence of the film Hot Fuzz. It discusses how various shots like extreme long shots, medium shots, and close-ups are used to build suspense around the main character and establish him as a serious and accomplished police officer, despite hints that the film will have comedic elements. Transitions between shots use flashes or match cuts to keep the sequence intense as the character's backstory and achievements are laid out. The cinematography and narration work together to present the main character as a perfect officer before the absurd comedy of the film is revealed.Micro elements
Micro elementssimply24
Ìý
This document discusses various micro elements used in film openings, including shots like extreme close-ups, close-ups, medium shots, and long shots. It also covers camera movements like pans, tilts, tracks, and zooms. Additional elements discussed are pace, performance, diegetic and non-diegetic sound, and mise-en-scene.Kane gibbons conventions question main
Kane gibbons conventions question mainkanegibbons1
Ìý
The document discusses conventions of film narratives and how the author's short film compares. It begins by outlining Todorov's narrative theory of equilibrium disruption-climax-resolution. It analyzes the 2008 film Taken as an example. The author's narrative follows conventions at first but breaks from expectations by having the protagonist fail to communicate with the woman due to a language barrier. The document also discusses conventional camera shot sizes and how the author incorporated standard shots as well as innovative shots like through a beer glass. Regarding sound, it notes challenges of low-budget production but how the author overcame this through enhanced dialogue recording and an artificial sound overlay.Question 7 neww
Question 7 newwJemPinto
Ìý
The document summarizes the filming and editing process for a group project, noting several flaws. Planning helped with scenes and continuity, but more practice was needed for filming and editing skills. Shots were established to set the location and introduce characters, but errors were made regarding continuity of door positions between shots. Reaction shots were missing that would have improved the dialogue scenes. Issues with leg positioning and clarity of a bite wound highlight flaws in maintaining the 180 degree rule during editing.Film language
Film languageclarkelucy2051
Ìý
The document defines several key terms related to film language, including opening sequences, diegesis, synchronous and asynchronous sound, parallel and contrapuntal sound, shot types, camera movements, and mise-en-scene. An opening sequence should introduce characters, location, genre, and a hook. Diegesis refers to everything visible within the film. Synchronous sound fits the on-screen action while asynchronous does not. Parallel sound matches mood and contrapuntal contrasts it. Shot types convey distance and camera movements create dynamics. Mise-en-scene encompasses visual elements that enhance storytelling.Snap
Snapsarahfeeman1993
Ìý
This document provides a detailed textual analysis of the short film "Snap" in 3 sections:
1. Micro analysis of camera techniques, shot types, movement, framing and depth of field.
2. Macro analysis of genre codes/conventions and how expectations are satisfied.
3. Narrative analysis of perspective, time representation, character roles, and structure.
The analysis finds that simple concepts and original ideas work best, and characters are not always the most essential element. Techniques like tracking shots and slow motion are effectively used to convey meaning. Overall it provides insights into short film techniques that could influence the reviewer's own productions.Camera shots camera movements camera angles
Camera shots camera movements camera anglesTafi123
Ìý
The document discusses various camera techniques used in filmmaking including shots, angles, movements, and lighting. It provides definitions and examples of different shot types like extreme long shot, long shot, mid shot, and close-up. It also defines high angles, eye-level angles, and low angles. Camera movements like panning, tracking shots, and dolly shots are explained. The document stresses that these techniques are used purposefully by filmmakers to shape meaning and influence the audience.Film language
Film language Boluwatifé Famodun
Ìý
This document provides descriptions and examples of different types of camera shots that can be used in filmmaking. It discusses shots like the over the shoulder shot, close-up, tilt shot, two-shot, and zoom in/out shots. It explains how each shot is composed and the purpose it serves, such as showing facial expressions, introducing characters, or depicting conversations. The document also summarizes a task where the author captured various shots with a camera group and learned about selecting shots to emphasize genre and tell a film's story.Representation in films
Representation in filmsBeckyMoffatASMedia
Ìý
The document discusses representations of teenagers in the opening scenes of two films: Clueless and Submarine.
The opening of Clueless uses bright colors, high key lighting, fast editing and a lively song to represent the teenage characters as happy and interested in partying rather than school. This provides a negative representation that is hard for audiences to relate to.
In contrast, the opening of Submarine uses low key lighting, close-ups of a character looking blankly, high angles and fast pacing to suggest the main character feels small and isolated living a fast-paced but anxious life. Non-diegetic bird sounds imply a quiet, isolated setting representing lonely teenagers. The protagonist also speaks in a monotLesson 12 - Animation.pptxHJSDFHHJKFKFGGHHFKHKF
Lesson 12 - Animation.pptxHJSDFHHJKFKFGGHHFKHKFDwayneAshleySilvenia
Ìý
,JHFZXKfDKFsKDJSAHDFSHFDHSAHDFJKhhfGD VKYTKVEYTWKYTRKYTWQYTDYASTGDHFASDJHjhfkeydFKYRFKYWETKUTFKyagskjhdftfkuytwqekytrywtqkuyMore from oliviafarrell (15)
Prop list
Prop listoliviafarrell
Ìý
The document lists home office equipment including a keyboard, monitor, printer, telephone and wall mounted clock. It also lists a container of assorted sweets and a pair of black heels. The items are numbered for inventory purposes.Costume list
Costume listoliviafarrell
Ìý
The document provides a costume list and analysis for a character named Carly featured in various film shots. It describes the clothing, accessories, and colors used for Carly in different scenes and explains the suggested meanings and story implications. For example, an outfit with a scarf and t-shirt in shots 1, 4, and 12 is meant to suggest cold weather and that Carly has something to hide. Another outfit featuring a coat, bag, and jeans in multiple shots emphasizes fashion but a cold environment. The various costumes are meant to subtly convey details about Carly's personality, emotional state, and the surrounding context through symbolic meanings of the clothing choices and colors.Deafness research
Deafness researcholiviafarrell
Ìý
This document provides information about deafness and hard of hearing individuals in the UK. It begins by explaining key terms used to describe levels of hearing loss. It then shares some facts and figures, noting that approximately 9 million people in the UK are deaf or hard of hearing and the prevalence increases with age. Causes of hearing loss are also outlined, including age, disease, loud noise, and other medical conditions. The document discusses communication methods for those with hearing loss such as lip reading, sign language, and technology. It provides an overview of hearing aids and other assistive devices available.Production meetings
Production meetingsoliviafarrell
Ìý
The document summarizes the production meetings for a student film project over several sessions. It discusses the development of the narrative, location scouting, casting, filming initial scenes, reviewing footage, completing additional filming, and rough editing. The film's story is about a deaf girl who attends a sign language center to learn about how she lost her hearing.Media posters a2
Media posters a2oliviafarrell
Ìý
This document discusses three disability posters found through an online search. The first poster depicts deaf eyes to represent how deaf people rely on sight for communication. The second poster shows two women where one appears shy while being closely watched by the other, possibly representing overpowering or patronizing attitudes. The third poster uses advanced Photoshop techniques and bright colors on a technology-focused image that could inspire how the group portrays technology changes for their film poster.Location recce
Location recceoliviafarrell
Ìý
Permission was obtained to film at an empty office and a bar in Slough. At the office, emergency exits were identified and the lighting could be adjusted as needed. A test was done beforehand and no sound or video issues were found. Filming details were confirmed with the crew. At the bar, areas inside and outside were checked for safety and the owner was aware of the filming. Most filming would be indoors or at night, and the crew had parking permission. Photos were taken of the locations beforehand to plan shots and avoid issues later.Double page spread
Double page spreadoliviafarrell
Ìý
The film follows a young woman named Laura who loses her hearing in a tragic accident. She goes to a sign language center seeking help in coming to terms with her deafness. The film flashes back to show the night of Laura's accident at a bar with friends that altered her life forever. By the end of the film, Laura is learning her first sign as she works to communicate in her new situation. The documentary aims to increase awareness of the challenges faced by deaf people, especially with communication and social situations.
The loggg
The logggoliviafarrell
Ìý
This document is a production log for a group school project detailing meetings between 4 students - Alice, Liv, Hannah, and Jack. It documents the development of their story idea, screenplay, storyboarding, and filming over several weeks. However, it notes that Hannah and then Jack left the group, leaving Alice and Liv to complete the project themselves. They finished editing their film and completed all associated folder work by the deadline.Media presentation once heard
Media presentation once heardoliviafarrell
Ìý
This document summarizes the process of creating a short film about deafness awareness. The group conducted research on deafness, reviewed similar films to identify conventions, and considered representation and target audiences. They decided on a storyline where the main character becomes deaf after an attack to bring awareness to challenges of living with disabilities. Advanced technology like DSLR cameras and editing software allowed professional-quality production. Ancillary materials like a poster further promoted the film's educational message.Toy story presentation
Toy story presentationoliviafarrell
Ìý
Toy Story is an animated film about Woody, a cowboy toy, whose position as Andy's favorite toy is threatened by the arrival of Buzz Lightyear. When Woody accidentally gets left behind during a family move, he and Buzz must work together to escape from Andy's neighbor and return to their rightful owner. The film was nominated for several awards for its animation and story. It uses techniques like point-of-view shots and lighting to develop its characters and story.Genre Mind Map
Genre Mind Mapoliviafarrell
Ìý
The document discusses the target audience, representation, editing techniques, genre, themes, ideology, and narrative of a short film created by the author. The target audience was 16+ due to topics covered and included portraying modern youth culture. Characters were portrayed as working class, white teenagers to allow for natural performances and audience relatability. Editing techniques from shows like Skins were utilized to engage audiences. The film aimed to raise awareness about disabilities through its themes while also portraying contemporary British culture like drinking at pubs. The narrative was non-linear with flashbacks to challenge conventions and maintain audience attention.Youth in the 60’s
Youth in the 60’soliviafarrell
Ìý
The mod subculture originated in London in the late 1950s and peaked in the early-to-mid 1960s. Mods listened to modern jazz, R&B, and beat music from bands like The Who. They favored tailored suits and rode Italian motor scooters. As youth began having more disposable income, boutique stores opened selling mod fashion. Mods and rockers were two youth subcultures that emerged in the early 1960s and clashed, with mods seen as sophisticated and rockers as scruffy.The exam media
- 2. Camera angles, movements & positions.Extreme close ups, close ups, medium shots, long shots, tilt shots.
- 3. Framing.Framing a shot helps realise who’s the most important character within the shot. There are plenty of different types of framing used in this short film...
- 4. Editing and Special Effects.The editing used mostly throughout the film is straight cuts and fades to each different shot. At the beginning there is a shot-reverse-shot showing a fast paced conversation between two characters.
- 9. Codes & Conventions.Usually alot more editing used in short films. Audiences expectations are satisfied due to the twist at the ending.
- 10. Representation.The characters are represented through the use of the camera because of the different shots and levels used.This also follows the stereotypes. I think that age is being shown here that even in university some people never grow up because otherwise you’d know not to get drunk before your last exam.
- 11. Audience.Teenagers and University studentswho just think that life will come easy to them. The audience will respond well to this film and also relate to its comedy genre.16+ due to bad language etc.
- 12. Themes/MessagesLife doesn’t come easy, you have to work hard to get where you want to be!